Recombinant Human JAM2 protein, His-tagged

• Cat.No.: JAM2-3129H
• Product Overview: Recombinant Human JAM2 protein(P57087)(29-238aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 29-238aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 27.5 kDa
• AA Sequence: FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: JAM2 junctional adhesion molecule 2 [ Homo sapiens ]
• Official Symbol: JAM2
• Synonyms: JAM2; junctional adhesion molecule 2; C21orf43; junctional adhesion molecule B; CD322; JAM B; JAMB; VE JAM; JAM-2; JAM-IT/VE-JAM; vascular endothelial junction-associated molecule; JAM-B; VEJAM; PRO245; VE-JAM
• Gene ID: 58494
• mRNA Refseq: NM_021219
• Protein Refseq: NP_067042
• MIM: 606870
• UniProt ID: P57087