Recombinant Human JAM2 protein, His-tagged
Cat.No. : | JAM2-3129H |
Product Overview : | Recombinant Human JAM2 protein(P57087)(29-238aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 29-238aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.5 kDa |
AA Sequence : | FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | JAM2 junctional adhesion molecule 2 [ Homo sapiens ] |
Official Symbol | JAM2 |
Synonyms | JAM2; junctional adhesion molecule 2; C21orf43; junctional adhesion molecule B; CD322; JAM B; JAMB; VE JAM; JAM-2; JAM-IT/VE-JAM; vascular endothelial junction-associated molecule; JAM-B; VEJAM; PRO245; VE-JAM; |
Gene ID | 58494 |
mRNA Refseq | NM_021219 |
Protein Refseq | NP_067042 |
MIM | 606870 |
UniProt ID | P57087 |
◆ Recombinant Proteins | ||
Jam2-909M | Active Recombinant Mouse Jam2 protein, hFc-tagged | +Inquiry |
JAM2-817H | Recombinant Human JAM2 | +Inquiry |
Jam2-7493R | Recombinant Rat Jam2 protein(Met1-Asn236), His-tagged | +Inquiry |
JAM2-1428H | Recombinant Human JAM2 Protein (29-238 aa), His-tagged | +Inquiry |
JAM2-1735R | Recombinant Rhesus Monkey JAM2 Protein, hIgG1-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JAM2-2123MCL | Recombinant Mouse JAM2 cell lysate | +Inquiry |
JAM2-1399RCL | Recombinant Rat JAM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JAM2 Products
Required fields are marked with *
My Review for All JAM2 Products
Required fields are marked with *