Recombinant Human KAT2A protein, GST-tagged

Cat.No. : KAT2A-5765H
Product Overview : Recombinant Human KAT2A protein(366-449 aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 366-449 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : EIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name KAT2A K(lysine) acetyltransferase 2A [ Homo sapiens ]
Official Symbol KAT2A
Synonyms KAT2A; K(lysine) acetyltransferase 2A; GCN5 general control of amino acid synthesis 5 like 2 (yeast) , GCN5L2; histone acetyltransferase KAT2A; GCN5; PCAF b; STAF97; hsGCN5; lysine acetyltransferase 2A; histone acetyltransferase GCN5; general control of amino acid synthesis protein 5-like 2; General control of amino acid synthesis, yeast, homolog-like 2; GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2; hGCN5; GCN5L2; PCAF-b; MGC102791;
Gene ID 2648
mRNA Refseq NM_021078
Protein Refseq NP_066564
MIM 602301
UniProt ID Q92830

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KAT2A Products

Required fields are marked with *

My Review for All KAT2A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon