Recombinant Human KAT2A protein, GST-tagged

• Cat.No.: KAT2A-5765H
• Product Overview: Recombinant Human KAT2A protein(366-449 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 366-449 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: EIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: KAT2A K(lysine) acetyltransferase 2A [ Homo sapiens ]
• Official Symbol: KAT2A
• Synonyms: KAT2A; K(lysine) acetyltransferase 2A; GCN5 general control of amino acid synthesis 5 like 2 (yeast) , GCN5L2; histone acetyltransferase KAT2A; GCN5; PCAF b; STAF97; hsGCN5; lysine acetyltransferase 2A; histone acetyltransferase GCN5; general control of amino acid synthesis protein 5-like 2; General control of amino acid synthesis, yeast, homolog-like 2; GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2; hGCN5; GCN5L2; PCAF-b; MGC102791
• Gene ID: 2648
• mRNA Refseq: NM_021078
• Protein Refseq: NP_066564
• MIM: 602301
• UniProt ID: Q92830