Recombinant Human KAT6A Protein, GST-tagged
Cat.No. : | KAT6A-5866H |
Product Overview : | Human MYST3 partial ORF ( NP_006757, 81 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the MOZ, YBFR2, SAS2, TIP60 family of histone acetyltransferases. The protein is composed of a nuclear localization domain, a double C2H2 zinc finger domain that binds to acetylated histone tails, a histone acetyl-transferase domain, a glutamate/aspartate-rich region, and a serine- and methionine-rich transactivation domain. It is part of a complex that acetylates lysine-9 residues in histone 3, and in addition, it acts as a co-activator for several transcription factors. Allelic variants of this gene are associated with an autosomal dominant form of cognitive disability. Chromosomal translocations of this gene are associated with acute myeloid leukemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2017] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KAT6A lysine acetyltransferase 6A [ Homo sapiens (human) ] |
Official Symbol | KAT6A |
Synonyms | KAT6A; lysine acetyltransferase 6A; MOZ; MRD32; MYST3; MYST-3; ZNF220; RUNXBP2; ZC2HC6A; histone acetyltransferase KAT6A; K(lysine) acetyltransferase 6A; MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3; MYST histone acetyltransferase (monocytic leukemia) 3; histone acetyltransferase MYST3; monocytic leukemia zinc finger protein; runt-related transcription factor binding protein 2; zinc finger protein 220; EC 2.3.1.48 |
Gene ID | 7994 |
mRNA Refseq | NM_001305878 |
Protein Refseq | NP_001292807 |
MIM | 601408 |
UniProt ID | Q92794 |
◆ Recombinant Proteins | ||
KAT6A-2812R | Recombinant Rat KAT6A Protein, His (Fc)-Avi-tagged | +Inquiry |
KAT6A-6689Z | Recombinant Zebrafish KAT6A | +Inquiry |
KAT6A-3219H | Recombinant Human KAT6A protein, GST-tagged | +Inquiry |
KAT6A-5866H | Recombinant Human KAT6A Protein, GST-tagged | +Inquiry |
KAT6A-3156R | Recombinant Rat KAT6A Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KAT6A Products
Required fields are marked with *
My Review for All KAT6A Products
Required fields are marked with *
0
Inquiry Basket