Recombinant Human KAT6A protein, GST-tagged
Cat.No. : | KAT6A-3219H |
Product Overview : | Recombinant Human KAT6A protein(420-510 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 420-510 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | SPDGRKARGEVVDYSEQYRIRKRGNRKSSTSDWPTDNQDGWDGKQENEERLFGSQEIMTEKDMELFRDIQEQALQKVGVTGPPDPQVRCPS |
Gene Name | KAT6A K(lysine) acetyltransferase 6A [ Homo sapiens ] |
Official Symbol | KAT6A |
Synonyms | KAT6A; K(lysine) acetyltransferase 6A; MYST histone acetyltransferase (monocytic leukemia) 3 , MYST3, runt related transcription factor binding protein 2 , RUNXBP2, ZNF220; histone acetyltransferase KAT6A; Monocytic leukemia zinc finger protein; MOZ; MYST-3; zinc finger protein 220; histone acetyltransferase MYST3; MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3; runt-related transcription factor binding protein 2; runt-related transcription factor-binding protein 2; MYST histone acetyltransferase (monocytic leukemia) 3; MYST3; ZNF220; RUNXBP2; MGC167033; |
Gene ID | 7994 |
mRNA Refseq | NM_001099412 |
Protein Refseq | NP_001092882 |
MIM | 601408 |
UniProt ID | Q92794 |
◆ Recombinant Proteins | ||
KAT6A-3219H | Recombinant Human KAT6A protein, GST-tagged | +Inquiry |
KAT6A-6689Z | Recombinant Zebrafish KAT6A | +Inquiry |
KAT6A-3156R | Recombinant Rat KAT6A Protein | +Inquiry |
KAT6A-12H | Recombinant Human KAT6A Protein (488-778), N-hFc tagged | +Inquiry |
KAT6A-5866H | Recombinant Human KAT6A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KAT6A Products
Required fields are marked with *
My Review for All KAT6A Products
Required fields are marked with *