Recombinant Human KCNMB3 Protein, GST-tagged

Cat.No. : KCNMB3-32H
Product Overview : Recombinant Human KCNMB3 Protein(82-207 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 82-207 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : KPFMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNGTPFSCFYSPASQSEDVILIKKYDQ
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol KCNMB3
Synonyms KCNMB3; potassium large conductance calcium-activated channel, subfamily M beta member 3; KCNMB2, KCNMBL; calcium-activated potassium channel subunit beta-3; slo-beta-3; K(VCA)beta-3; BK channel subunit beta-3; maxi K channel subunit beta-3; charybdotoxin receptor subunit beta-3; calcium-activated potassium channel, subfamily M subunit beta-3; large conductance, voltage and Ca2+ activated potassium channel Maxi K beta 3 subunit; HBETA3; KCNMB2; KCNMBL; BKBETA3; SLOBETA3;
Gene ID 27094
mRNA Refseq NM_001163677
Protein Refseq NP_001157149
MIM 605222
UniProt ID Q9NPA1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNMB3 Products

Required fields are marked with *

My Review for All KCNMB3 Products

Required fields are marked with *

0
cart-icon
0
compare icon