Recombinant Human KCNMB3 Protein, GST-tagged
Cat.No. : | KCNMB3-32H |
Product Overview : | Recombinant Human KCNMB3 Protein(82-207 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 82-207 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | KPFMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNGTPFSCFYSPASQSEDVILIKKYDQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | KCNMB3 |
Synonyms | KCNMB3; potassium large conductance calcium-activated channel, subfamily M beta member 3; KCNMB2, KCNMBL; calcium-activated potassium channel subunit beta-3; slo-beta-3; K(VCA)beta-3; BK channel subunit beta-3; maxi K channel subunit beta-3; charybdotoxin receptor subunit beta-3; calcium-activated potassium channel, subfamily M subunit beta-3; large conductance, voltage and Ca2+ activated potassium channel Maxi K beta 3 subunit; HBETA3; KCNMB2; KCNMBL; BKBETA3; SLOBETA3; |
Gene ID | 27094 |
mRNA Refseq | NM_001163677 |
Protein Refseq | NP_001157149 |
MIM | 605222 |
UniProt ID | Q9NPA1 |
◆ Recombinant Proteins | ||
KCNMB3-32H | Recombinant Human KCNMB3 Protein, GST-tagged | +Inquiry |
KCNMB3-33H | Recombinant Human KCNMB3 Protein, hFc-His-tagged | +Inquiry |
KCNMB3-2873R | Recombinant Rat KCNMB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNMB3-3217R | Recombinant Rat KCNMB3 Protein | +Inquiry |
◆ Native Proteins | ||
KCNMB3-20H | Recombinant Human KCNMB3 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNMB3-5024HCL | Recombinant Human KCNMB3 293 Cell Lysate | +Inquiry |
KCNMB3-5023HCL | Recombinant Human KCNMB3 293 Cell Lysate | +Inquiry |
KCNMB3-5025HCL | Recombinant Human KCNMB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNMB3 Products
Required fields are marked with *
My Review for All KCNMB3 Products
Required fields are marked with *
0
Inquiry Basket