Recombinant Human KCNMB3 Protein, His tagged

Cat.No. : KCNMB3-20H
Product Overview : Recombinant human KCNMB3 (82-207 aa) fused to His-tag at N terminus, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 82-207 aa
Description : MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which may partially inactivate or slightly decrease the activation time of MaxiK alpha subunit currents. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 22.
Form : Liquid
Molecular Mass : 16.8 kDa (149aa)
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSKPFMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNGTPFSCFYSPASQSEDVILIKKYDQ
Purity : > 85% by SDS-PAGE
Applications : SDS-PAGE, Denatured
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0) containing 0.4M uREA, 10% glycerol
Concentration : 1 mg/mL (determined by Bradford assay)
Reference : 1. Lee,u.S, et al. (2009) J. Physiol. (Lond.) 587 (PT 7), 1481-1498 2. Zeng,X., et al. (2008) J. Gen. Physiol. 132 (1), 115-129
Gene Name KCNMB3 potassium calcium-activated channel subfamily M regulatory beta subunit 3 [ Homo sapiens (human) ]
Official Symbol KCNMB3
Synonyms KCNMB3; potassium large conductance calcium-activated channel, subfamily M beta member 3; KCNMB2, KCNMBL; calcium-activated potassium channel subunit beta-3; slo-beta-3; K(VCA)beta-3; BK channel subunit beta-3; maxi K channel subunit beta-3; charybdotoxin receptor subunit beta-3; calcium-activated potassium channel, subfamily M subunit beta-3; large conductance, voltage and Ca2+ activated potassium channel Maxi K beta 3 subunit; HBETA3; KCNMB2; KCNMBL; BKBETA3; SLOBETA3
Gene ID 27094
mRNA Refseq NM_014407
Protein Refseq NP_055222
MIM 605222
UniProt ID Q9NPA1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNMB3 Products

Required fields are marked with *

My Review for All KCNMB3 Products

Required fields are marked with *

0
cart-icon
0
compare icon