Recombinant Human KCNMB3 Protein, His tagged
Cat.No. : | KCNMB3-20H |
Product Overview : | Recombinant human KCNMB3 (82-207 aa) fused to His-tag at N terminus, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 82-207 aa |
Description : | MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which may partially inactivate or slightly decrease the activation time of MaxiK alpha subunit currents. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 22. |
Form : | Liquid |
Molecular Mass : | 16.8 kDa (149aa) |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSKPFMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNGTPFSCFYSPASQSEDVILIKKYDQ |
Purity : | > 85% by SDS-PAGE |
Applications : | SDS-PAGE, Denatured |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Storage Buffer : | 20mM Tris-HCl buffer (pH 8.0) containing 0.4M uREA, 10% glycerol |
Concentration : | 1 mg/mL (determined by Bradford assay) |
Reference : | 1. Lee,u.S, et al. (2009) J. Physiol. (Lond.) 587 (PT 7), 1481-1498 2. Zeng,X., et al. (2008) J. Gen. Physiol. 132 (1), 115-129 |
Gene Name | KCNMB3 potassium calcium-activated channel subfamily M regulatory beta subunit 3 [ Homo sapiens (human) ] |
Official Symbol | KCNMB3 |
Synonyms | KCNMB3; potassium large conductance calcium-activated channel, subfamily M beta member 3; KCNMB2, KCNMBL; calcium-activated potassium channel subunit beta-3; slo-beta-3; K(VCA)beta-3; BK channel subunit beta-3; maxi K channel subunit beta-3; charybdotoxin receptor subunit beta-3; calcium-activated potassium channel, subfamily M subunit beta-3; large conductance, voltage and Ca2+ activated potassium channel Maxi K beta 3 subunit; HBETA3; KCNMB2; KCNMBL; BKBETA3; SLOBETA3 |
Gene ID | 27094 |
mRNA Refseq | NM_014407 |
Protein Refseq | NP_055222 |
MIM | 605222 |
UniProt ID | Q9NPA1 |
◆ Recombinant Proteins | ||
KCNMB3-32H | Recombinant Human KCNMB3 Protein, GST-tagged | +Inquiry |
KCNMB3-33H | Recombinant Human KCNMB3 Protein, hFc-His-tagged | +Inquiry |
KCNMB3-2873R | Recombinant Rat KCNMB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNMB3-3217R | Recombinant Rat KCNMB3 Protein | +Inquiry |
◆ Native Proteins | ||
KCNMB3-20H | Recombinant Human KCNMB3 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNMB3-5025HCL | Recombinant Human KCNMB3 293 Cell Lysate | +Inquiry |
KCNMB3-5024HCL | Recombinant Human KCNMB3 293 Cell Lysate | +Inquiry |
KCNMB3-5023HCL | Recombinant Human KCNMB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNMB3 Products
Required fields are marked with *
My Review for All KCNMB3 Products
Required fields are marked with *