Recombinant Human KCTD6 protein, GST-tagged
Cat.No. : | KCTD6-1234H |
Product Overview : | Recombinant Human KCTD6 protein(98-237 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 98-237 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | IEPLIQCLNDPKPLYPMDTFEEVVELSSTRKLSKYSNPVAVIITQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERANENTVEHNWTFCRLARKTDD |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | KCTD6 potassium channel tetramerisation domain containing 6 [ Homo sapiens ] |
Official Symbol | KCTD6 |
Synonyms | KCTD6; potassium channel tetramerisation domain containing 6; BTB/POZ domain-containing protein KCTD6; KCASH3; MGC27385; |
mRNA Refseq | NM_001128214 |
Protein Refseq | NP_001121686 |
UniProt ID | Q8NC69 |
Gene ID | 200845 |
◆ Recombinant Proteins | ||
Kctd6-3675M | Recombinant Mouse Kctd6 Protein, Myc/DDK-tagged | +Inquiry |
KCTD6-870H | Recombinant Human KCTD6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KCTD6-5873H | Recombinant Human KCTD6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KCTD6-2726H | Recombinant Human KCTD6 Protein (Full Length), N-His tagged | +Inquiry |
KCTD6-1234H | Recombinant Human KCTD6 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCTD6-894HCL | Recombinant Human KCTD6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCTD6 Products
Required fields are marked with *
My Review for All KCTD6 Products
Required fields are marked with *