Recombinant Human KCTD6 protein, His-tagged
Cat.No. : | KCTD6-2660H |
Product Overview : | Recombinant Human KCTD6 protein(98-237 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 98-237 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | IEPLIQCLNDPKPLYPMDTFEEVVELSSTRKLSKYSNPVAVIITQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERANENTVEHNWTFCRLARKTDD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KCTD6 potassium channel tetramerisation domain containing 6 [ Homo sapiens ] |
Official Symbol | KCTD6 |
Synonyms | KCTD6; potassium channel tetramerisation domain containing 6; BTB/POZ domain-containing protein KCTD6; KCASH3; MGC27385; |
Gene ID | 200845 |
mRNA Refseq | NM_001128214 |
Protein Refseq | NP_001121686 |
UniProt ID | Q8NC69 |
◆ Recombinant Proteins | ||
KCTD6-5873H | Recombinant Human KCTD6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KCTD6-870H | Recombinant Human KCTD6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KCTD6-2726H | Recombinant Human KCTD6 Protein (Full Length), N-His tagged | +Inquiry |
KCTD6-2660H | Recombinant Human KCTD6 protein, His-tagged | +Inquiry |
Kctd6-3675M | Recombinant Mouse Kctd6 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCTD6-894HCL | Recombinant Human KCTD6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCTD6 Products
Required fields are marked with *
My Review for All KCTD6 Products
Required fields are marked with *
0
Inquiry Basket