Recombinant Human KDSR, His-tagged

Cat.No. : KDSR-26267TH
Product Overview : Recombinant fragment corresponding to amino acids 26-270 of Human FVT1 with an N terminal His tag; 266 amino acids with tag, MWt 29 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 245 amino acids
Description : The protein encoded by this gene catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine. The putative active site residues of the encoded protein are found on the cytosolic side of the endoplasmic reticulum membrane. A chromosomal rearrangement involving this gene is a cause of follicular lymphoma, also known as type II chronic lymphatic leukemia. The mutation of a conserved residue in the bovine ortholog causes spinal muscular atrophy.
Conjugation : HIS
Molecular Weight : 29.000kDa inclusive of tags
Tissue specificity : Expressed in all tissues examined. Highest expression in placenta. High expression in lung, kidney, stomach and small intestine, low expression in heart, spleen and skeletal muscle. Weakly expressed in normal hematopoietic tissues. Higher expression in so
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSD
Sequence Similarities : Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Gene Name KDSR 3-ketodihydrosphingosine reductase [ Homo sapiens ]
Official Symbol KDSR
Synonyms KDSR; 3-ketodihydrosphingosine reductase; follicular lymphoma variant translocation 1 , FVT1; 3 dehydrosphinganine reductase; DHSR; SDR35C1; short chain dehydrogenase/reductase family 35C; member 1;
Gene ID 2531
mRNA Refseq NM_002035
Protein Refseq NP_002026
MIM 136440
Uniprot ID Q06136
Chromosome Location 18q21
Pathway Metabolic pathways, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, conserved biosystem;
Function 3-dehydrosphinganine reductase activity; nucleotide binding; oxidoreductase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KDSR Products

Required fields are marked with *

My Review for All KDSR Products

Required fields are marked with *

0
cart-icon