Recombinant Human KDSR, His-tagged
Cat.No. : | KDSR-26267TH |
Product Overview : | Recombinant fragment corresponding to amino acids 26-270 of Human FVT1 with an N terminal His tag; 266 amino acids with tag, MWt 29 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 245 amino acids |
Description : | The protein encoded by this gene catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine. The putative active site residues of the encoded protein are found on the cytosolic side of the endoplasmic reticulum membrane. A chromosomal rearrangement involving this gene is a cause of follicular lymphoma, also known as type II chronic lymphatic leukemia. The mutation of a conserved residue in the bovine ortholog causes spinal muscular atrophy. |
Conjugation : | HIS |
Molecular Weight : | 29.000kDa inclusive of tags |
Tissue specificity : | Expressed in all tissues examined. Highest expression in placenta. High expression in lung, kidney, stomach and small intestine, low expression in heart, spleen and skeletal muscle. Weakly expressed in normal hematopoietic tissues. Higher expression in so |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSD |
Sequence Similarities : | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
Gene Name | KDSR 3-ketodihydrosphingosine reductase [ Homo sapiens ] |
Official Symbol | KDSR |
Synonyms | KDSR; 3-ketodihydrosphingosine reductase; follicular lymphoma variant translocation 1 , FVT1; 3 dehydrosphinganine reductase; DHSR; SDR35C1; short chain dehydrogenase/reductase family 35C; member 1; |
Gene ID | 2531 |
mRNA Refseq | NM_002035 |
Protein Refseq | NP_002026 |
MIM | 136440 |
Uniprot ID | Q06136 |
Chromosome Location | 18q21 |
Pathway | Metabolic pathways, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, conserved biosystem; |
Function | 3-dehydrosphinganine reductase activity; nucleotide binding; oxidoreductase activity; |
◆ Recombinant Proteins | ||
KDSR-1243H | Recombinant Human KDSR Protein, His (Fc)-Avi-tagged | +Inquiry |
Kdsr-742M | Recombinant Mouse Kdsr Protein, His-tagged | +Inquiry |
Kdsr-3685M | Recombinant Mouse Kdsr Protein, Myc/DDK-tagged | +Inquiry |
KDSR-3461H | Recombinant Human KDSR protein, His-tagged | +Inquiry |
RFL29169HF | Recombinant Full Length Human 3-Ketodihydrosphingosine Reductase(Kdsr) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDSR-356HCL | Recombinant Human KDSR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KDSR Products
Required fields are marked with *
My Review for All KDSR Products
Required fields are marked with *