Recombinant Human KHK protein, GST-tagged
| Cat.No. : | KHK-3134H |
| Product Overview : | Recombinant Human KHK protein(P50053)(1-298aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-298aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 59.7 kDa |
| AA Sequence : | MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | KHK ketohexokinase (fructokinase) [ Homo sapiens ] |
| Official Symbol | KHK |
| Synonyms | KHK; ketohexokinase (fructokinase); ketohexokinase; hepatic fructokinase; |
| Gene ID | 3795 |
| mRNA Refseq | NM_000221 |
| Protein Refseq | NP_000212 |
| MIM | 614058 |
| UniProt ID | P50053 |
| ◆ Recombinant Proteins | ||
| Khk-3135M | Recombinant Mouse Khk protein, His-tagged | +Inquiry |
| KHK-2902R | Recombinant Rat KHK Protein, His (Fc)-Avi-tagged | +Inquiry |
| KHK-905H | Recombinant Human Ketohexokinase (fructokinase) | +Inquiry |
| KHK-450H | Active Recombinant Human KHK, His-tagged | +Inquiry |
| KHK-151H | Recombinant Human KHK protein, T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KHK-4985HCL | Recombinant Human KHK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KHK Products
Required fields are marked with *
My Review for All KHK Products
Required fields are marked with *
