Recombinant Human KLF5 protein, T7/His-tagged
Cat.No. : | KLF5-133H |
Product Overview : | Recombinant human KLF5 cDNA (457aa, derived from BC042131) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFP GEELKHAHHRPQAQPAPAQAPQPAQPPATGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVVDQ FFTDTEGLPYSINMNVFLPDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPPAPTQALPEFTSIFSSHQ TAAPEVNNIFIKQELPTPDLHLSVPTQQGHLYQLLNTPDLDMPSSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQ TAVKQFQGMPPCTYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTL PVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTR HYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | KLF5 Kruppel-like factor 5 (intestinal) [ Homo sapiens ] |
Official Symbol | KLF5 |
Synonyms | KLF5; Kruppel-like factor 5 (intestinal); BTEB2; Krueppel-like factor 5; CKLF; IKLF; BTE-binding protein 2; GC box binding protein 2; GC-box-binding protein 2; colon kruppel-like factor; colon krueppel-like factor; transcription factor BTEB2; intestinal-enriched kruppel-like factor; intestinal-enriched krueppel-like factor; basic transcription element binding protein 2; basic transcription element-binding protein 2; |
Gene ID | 688 |
mRNA Refseq | NM_001730 |
Protein Refseq | NP_001721 |
MIM | 602903 |
UniProt ID | Q13887 |
Chromosome Location | 13q21.3 |
Pathway | Adipogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Transcriptional Regulation of White Adipocyte Differentiation, organism-specific biosystem; |
Function | DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
◆ Recombinant Proteins | ||
KLF5-4840M | Recombinant Mouse KLF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLF5-133H | Recombinant Human KLF5 protein, T7/His-tagged | +Inquiry |
KLF5-3003H | Recombinant Human KLF5 Protein | +Inquiry |
KLF5-134H | Recombinant Human KLF5 protein, His-tagged | +Inquiry |
KLF5-8685M | Recombinant Mouse KLF5 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLF5 Products
Required fields are marked with *
My Review for All KLF5 Products
Required fields are marked with *
0
Inquiry Basket