Recombinant Human KLK2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | KLK2-4486H |
Product Overview : | KLK2 MS Standard C13 and N15-labeled recombinant protein (NP_005542) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the grandular kallikrein protein family. Kallikreins are a subgroup of serine proteases that are clustered on chromosome 19. Members of this family are involved in a diverse array of biological functions. The protein encoded by this gene is a highly active trypsin-like serine protease that selectively cleaves at arginine residues. This protein is primarily expressed in prostatic tissue and is responsible for cleaving pro-prostate-specific antigen into its enzymatically active form. This gene is highly expressed in prostate tumor cells and may be a prognostic maker for prostate cancer risk. Alternate splicing results in both coding and non-coding transcript variants. |
Molecular Mass : | 28.7 kDa |
AA Sequence : | MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | KLK2 kallikrein-related peptidase 2 [ Homo sapiens (human) ] |
Official Symbol | KLK2 |
Synonyms | KLK2; kallikrein-related peptidase 2; kallikrein 2, prostatic; kallikrein-2; tissue kallikrein-2; glandular kallikrein 2; glandular kallikrein-1; hK2; hGK-1; KLK2A2; FLJ17010; FLJ17011; MGC12201; |
Gene ID | 3817 |
mRNA Refseq | NM_005551 |
Protein Refseq | NP_005542 |
MIM | 147960 |
UniProt ID | P20151 |
◆ Recombinant Proteins | ||
KLK2-4351H | Recombinant Human KLK2 Protein (Pro19-Pro261), N-His tagged | +Inquiry |
KLK2-2372H | Recombinant Human KLK2 Protein, His-tagged | +Inquiry |
KLK2-152H | Active Recombinant Human KLK2 protein, His-tagged | +Inquiry |
KLK2-2373H | Recombinant Human KLK2 Protein, His-tagged | +Inquiry |
KLK2-1257H | Recombinant Human KLK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK2-947HCL | Recombinant Human KLK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLK2 Products
Required fields are marked with *
My Review for All KLK2 Products
Required fields are marked with *
0
Inquiry Basket