Recombinant Human KRT1 Protein, GST-tagged

Cat.No. : KRT1-4876H
Product Overview : Human KRT1 partial ORF ( NP_006112, 387 a.a. - 496 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the spinous and granular layers of the epidermis with family member KRT10 and mutations in these genes have been associated with bullous congenital ichthyosiform erythroderma. The type II cytokeratins are clustered in a region of chromosome 12q12-q13. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : HGDSVRNSKIEISELNRVIQRLRSEIDNVKKQISNLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIATYRTLLEGEESRMSGE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRT1 keratin 1 [ Homo sapiens ]
Official Symbol KRT1
Synonyms KRT1; keratin 1; EHK1, epidermolytic hyperkeratosis 1; keratin, type II cytoskeletal 1; KRT1A; CK-1; cytokeratin 1; cytokeratin-1; 67 kDa cytokeratin; hair alpha protein; type-II keratin Kb1; epidermolytic hyperkeratosis 1; K1; CK1; EHK; EHK1; EPPK; NEPPK;
Gene ID 3848
mRNA Refseq NM_006121
Protein Refseq NP_006112
MIM 139350
UniProt ID P04264

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRT1 Products

Required fields are marked with *

My Review for All KRT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon