Recombinant Human KRT2 protein, His&Myc-tagged
Cat.No. : | KRT2-8865H |
Product Overview : | Recombinant Human KRT2 protein(P35908)(1-639aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-639a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 72.9 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MSCQISCKSRGRGGGGGGFRGFSSGSAVVSGGSRRSTSSFSCLSRHGGGGGGFGGGGFGSRSLVGLGGTKSISISVAGGGGGFGAAGGFGGRGGGFGGGSSFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPGGFGPGGYPGGIHEVSVNQSLLQPLNVKVDPEIQNVKAQEREQIKTLNNKFASFIDKVRFLEQQNQVLQTKWELLQQMNVGTRPINLEPIFQGYIDSLKRYLDGLTAERTSQNSELNNMQDLVEDYKKKYEDEINKRTAAENDFVTLKKDVDNAYMIKVELQSKVDLLNQEIEFLKVLYDAEISQIHQSVTDTNVILSMDNSRNLDLDSIIAEVKAQYEEIAQRSKEEAEALYHSKYEELQVTVGRHGDSLKEIKIEISELNRVIQRLQGEIAHVKKQCKNVQDAIADAEQRGEHALKDARNKLNDLEEALQQAKEDLARLLRDYQELMNVKLALDVEIATYRKLLEGEECRMSGDLSSNVTVSVTSSTISSNVASKAAFGGSGGRGSSSGGGYSSGSSSYGSGGRQSGSRGGSGGGGSISGGGYGSGGGSGGRYGSGGGSKGGSISGGGYGSGGGKHSSGGGSRGGSSSGGGYGSGGGGSSSVKGSSGEAFGSSVTFSFR |
Gene Name | KRT2 keratin 2 [ Homo sapiens ] |
Official Symbol | KRT2 |
Synonyms | KRT2; keratin 2; keratin 2A (epidermal ichthyosis bullosa of Siemens) , KRT2A; keratin, type II cytoskeletal 2 epidermal; epidermal ichthyosis bullosa of Siemens; KRTE; keratin-2e; cytokeratin-2e; keratin-2 epidermis; type-II keratin Kb2; epithelial keratin-2e; K2e; CK-2e; KRT2A; KRT2E; MGC116967; MGC116968; |
Gene ID | 3849 |
mRNA Refseq | NM_000423 |
Protein Refseq | NP_000414 |
MIM | 600194 |
UniProt ID | P35908 |
◆ Recombinant Proteins | ||
Krt2-2699R | Recombinant Rat Krt2 protein, His & S-tagged | +Inquiry |
KRT2-2413H | Recombinant Human KRT2 Protein (Cys7-Leu160), His tagged | +Inquiry |
KRT2-8865H | Recombinant Human KRT2 protein, His&Myc-tagged | +Inquiry |
KRT2-4915M | Recombinant Mouse KRT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRT2-2973R | Recombinant Rat KRT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KRT2 Products
Required fields are marked with *
My Review for All KRT2 Products
Required fields are marked with *
0
Inquiry Basket