Recombinant Human LCN12 protein, GST-tagged
| Cat.No. : | LCN12-301442H |
| Product Overview : | Recombinant Human LCN12 (406-532 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Asn406-Ile532 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | NSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRGQHCDTWSYVLIPAAQPGQFTVDHGVEPGADREETRVVDSDYTQFALMLSRRHTSRLAVLRISLLGRSWLLPPGTLDQFICLGRAQGLSDDNI |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | LCN12 lipocalin 12 [ Homo sapiens ] |
| Official Symbol | LCN12 |
| Synonyms | LCN12; lipocalin 12; epididymal-specific lipocalin-12; MGC48935; lipocalcin 12; MGC34753; |
| Gene ID | 286256 |
| mRNA Refseq | NM_178536 |
| Protein Refseq | NP_848631 |
| MIM | 612905 |
| UniProt ID | Q6JVE5 |
| ◆ Recombinant Proteins | ||
| LCN12-6754H | Recombinant Human LCN12 protein, GST-tagged | +Inquiry |
| LCN12-301442H | Recombinant Human LCN12 protein, GST-tagged | +Inquiry |
| LCN12-2477R | Recombinant Rhesus monkey LCN12 Protein, His-tagged | +Inquiry |
| Lcn12-501M | Recombinant Mouse Lcn12 Protein, His/GST-tagged | +Inquiry |
| LCN12-4212H | Recombinant Human LCN12 Protein (Leu61-Gly184), N-GST tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LCN12-975HCL | Recombinant Human LCN12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LCN12 Products
Required fields are marked with *
My Review for All LCN12 Products
Required fields are marked with *



