Recombinant Human LCN12 protein, GST-tagged
Cat.No. : | LCN12-301442H |
Product Overview : | Recombinant Human LCN12 (406-532 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Asn406-Ile532 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | NSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRGQHCDTWSYVLIPAAQPGQFTVDHGVEPGADREETRVVDSDYTQFALMLSRRHTSRLAVLRISLLGRSWLLPPGTLDQFICLGRAQGLSDDNI |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | LCN12 lipocalin 12 [ Homo sapiens ] |
Official Symbol | LCN12 |
Synonyms | LCN12; lipocalin 12; epididymal-specific lipocalin-12; MGC48935; lipocalcin 12; MGC34753; |
Gene ID | 286256 |
mRNA Refseq | NM_178536 |
Protein Refseq | NP_848631 |
MIM | 612905 |
UniProt ID | Q6JVE5 |
◆ Recombinant Proteins | ||
LCN12-301442H | Recombinant Human LCN12 protein, GST-tagged | +Inquiry |
Lcn12-502R | Recombinant Rat Lcn12 Protein, His/GST-tagged | +Inquiry |
LCN12-2477R | Recombinant Rhesus monkey LCN12 Protein, His-tagged | +Inquiry |
LCN12-2298R | Recombinant Rhesus Macaque LCN12 Protein, His (Fc)-Avi-tagged | +Inquiry |
LCN12-6754H | Recombinant Human LCN12 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCN12-975HCL | Recombinant Human LCN12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LCN12 Products
Required fields are marked with *
My Review for All LCN12 Products
Required fields are marked with *
0
Inquiry Basket