Recombinant Human LCN12 protein, GST-tagged

Cat.No. : LCN12-301442H
Product Overview : Recombinant Human LCN12 (406-532 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Asn406-Ile532
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : NSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRGQHCDTWSYVLIPAAQPGQFTVDHGVEPGADREETRVVDSDYTQFALMLSRRHTSRLAVLRISLLGRSWLLPPGTLDQFICLGRAQGLSDDNI
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name LCN12 lipocalin 12 [ Homo sapiens ]
Official Symbol LCN12
Synonyms LCN12; lipocalin 12; epididymal-specific lipocalin-12; MGC48935; lipocalcin 12; MGC34753;
Gene ID 286256
mRNA Refseq NM_178536
Protein Refseq NP_848631
MIM 612905
UniProt ID Q6JVE5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LCN12 Products

Required fields are marked with *

My Review for All LCN12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon