Recombinant Human LDLR

Cat.No. : LDLR-29938TH
Product Overview : Recombinant fragment corresponding to amino acids 105-205 of Human LDL Receptor with a proprietary tag; Predicted MWt 36.74 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 101 amino acids
Description : The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. Low density lipoprotein (LDL) is normally bound at the cell membrane and taken into the cell ending up in lysosomes where the protein is degraded and the cholesterol is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in this gene cause the autosomal dominant disorder, familial hypercholesterolemia. Alternate splicing results in multiple transcript variants.
Molecular Weight : 36.740kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCL
Sequence Similarities : Belongs to the LDLR family.Contains 3 EGF-like domains.Contains 7 LDL-receptor class A domains.Contains 6 LDL-receptor class B repeats.
Gene Name LDLR low density lipoprotein receptor [ Homo sapiens ]
Official Symbol LDLR
Synonyms LDLR; low density lipoprotein receptor; low-density lipoprotein receptor; familial hypercholesterolemia;
Gene ID 3949
mRNA Refseq NM_000527
Protein Refseq NP_000518
Uniprot ID P01130
Chromosome Location 19p13.2
Pathway Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Chylomicron-mediated lipid transport, organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; Endocytosis, organism-specific biosystem;
Function calcium ion binding; low-density lipoprotein particle binding; low-density lipoprotein receptor activity; protein binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LDLR Products

Required fields are marked with *

My Review for All LDLR Products

Required fields are marked with *

0
cart-icon
0
compare icon