Recombinant Human LDLR
| Cat.No. : | LDLR-29938TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 105-205 of Human LDL Receptor with a proprietary tag; Predicted MWt 36.74 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 101 amino acids |
| Description : | The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. Low density lipoprotein (LDL) is normally bound at the cell membrane and taken into the cell ending up in lysosomes where the protein is degraded and the cholesterol is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in this gene cause the autosomal dominant disorder, familial hypercholesterolemia. Alternate splicing results in multiple transcript variants. |
| Molecular Weight : | 36.740kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | PPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCL |
| Sequence Similarities : | Belongs to the LDLR family.Contains 3 EGF-like domains.Contains 7 LDL-receptor class A domains.Contains 6 LDL-receptor class B repeats. |
| Gene Name | LDLR low density lipoprotein receptor [ Homo sapiens ] |
| Official Symbol | LDLR |
| Synonyms | LDLR; low density lipoprotein receptor; low-density lipoprotein receptor; familial hypercholesterolemia; |
| Gene ID | 3949 |
| mRNA Refseq | NM_000527 |
| Protein Refseq | NP_000518 |
| Uniprot ID | P01130 |
| Chromosome Location | 19p13.2 |
| Pathway | Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Chylomicron-mediated lipid transport, organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; Endocytosis, organism-specific biosystem; |
| Function | calcium ion binding; low-density lipoprotein particle binding; low-density lipoprotein receptor activity; protein binding; receptor activity; |
| ◆ Recombinant Proteins | ||
| RFL14164BF | Recombinant Full Length Bovine Low-Density Lipoprotein Receptor(Ldlr) Protein, His-Tagged | +Inquiry |
| Ldlr-3283MB | Recombinant Mouse Ldlr protein, His-tagged, Biotinylated | +Inquiry |
| LDLR-1286H | Recombinant Human LDLR Protein, His (Fc)-Avi-tagged | +Inquiry |
| LDLR-0327H | Active Recombinant Human LDLR protein, Fc-tagged | +Inquiry |
| LDLR-2506H | Recombinant Human LDLR protein(31-100 aa), C-His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| LDLR-85H | Native Human Lipoprotein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LDLR-2780HCL | Recombinant Human LDLR cell lysate | +Inquiry |
| LDLR-2762MCL | Recombinant Mouse LDLR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LDLR Products
Required fields are marked with *
My Review for All LDLR Products
Required fields are marked with *
