Recombinant Human LEPR

Cat.No. : LEPR-29427TH
Product Overview : Recombinant fragment of Human Leptin Receptor protein with an N terminal proprietary tag; predicted mwt: 36.63 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene belongs to the gp130 family of cytokine receptors that are known to stimulate gene transcription via activation of cytosolic STAT proteins. This protein is a receptor for leptin (an adipocyte-specific hormone that regulates body weight), and is involved in the regulation of fat metabolism, as well as in a novel hematopoietic pathway that is required for normal lymphopoiesis. Mutations in this gene have been associated with obesity and pituitary dysfunction. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. It is noteworthy that this gene and LEPROT gene (GeneID:54741) share the same promoter and the first 2 exons, however, encode distinct proteins (PMID:9207021).
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Isoform A is expressed in fetal liver and in hematopoietic tissues and choroid plexus. In adults highest expression in heart, liver, small intestine, prostate and ovary. Low level in lung and kidney. Isoform B is highly expressed in hypothalamus.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : WRFKLSCMPPNSTYDYFLLPAGLSKNTSNSNGHYETAVEPKFNSSGTHFSNLSKTTFHCCFRSEQDRNCSLCADNIEGKTFVSTVNSLVFQQIDANWNIQ
Sequence Similarities : Belongs to the type I cytokine receptor family. Type 2 subfamily.Contains 4 fibronectin type-III domains.Contains 1 Ig-like (immunoglobulin-like) domain.
Gene ID LEPR leptin receptor [ Homo sapiens ]
Official Symbol LEPR
Synonyms LEPR; leptin receptor; CD295; OBR;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LEPR Products

Required fields are marked with *

My Review for All LEPR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon