Recombinant Human LEPR
Cat.No. : | LEPR-29427TH |
Product Overview : | Recombinant fragment of Human Leptin Receptor protein with an N terminal proprietary tag; predicted mwt: 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene belongs to the gp130 family of cytokine receptors that are known to stimulate gene transcription via activation of cytosolic STAT proteins. This protein is a receptor for leptin (an adipocyte-specific hormone that regulates body weight), and is involved in the regulation of fat metabolism, as well as in a novel hematopoietic pathway that is required for normal lymphopoiesis. Mutations in this gene have been associated with obesity and pituitary dysfunction. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. It is noteworthy that this gene and LEPROT gene (GeneID:54741) share the same promoter and the first 2 exons, however, encode distinct proteins (PMID:9207021). |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Isoform A is expressed in fetal liver and in hematopoietic tissues and choroid plexus. In adults highest expression in heart, liver, small intestine, prostate and ovary. Low level in lung and kidney. Isoform B is highly expressed in hypothalamus. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | WRFKLSCMPPNSTYDYFLLPAGLSKNTSNSNGHYETAVEPKFNSSGTHFSNLSKTTFHCCFRSEQDRNCSLCADNIEGKTFVSTVNSLVFQQIDANWNIQ |
Sequence Similarities : | Belongs to the type I cytokine receptor family. Type 2 subfamily.Contains 4 fibronectin type-III domains.Contains 1 Ig-like (immunoglobulin-like) domain. |
Gene ID | LEPR leptin receptor [ Homo sapiens ] |
Official Symbol | LEPR |
Synonyms | LEPR; leptin receptor; CD295; OBR; |
◆ Recombinant Proteins | ||
LEPR-2318R | Recombinant Rhesus Macaque LEPR Protein, His (Fc)-Avi-tagged | +Inquiry |
LEPR-5896C | Recombinant Chicken LEPR | +Inquiry |
LEPR-669H | Recombinant Human LEPR protein, His & T7-tagged | +Inquiry |
LEPR-1236H | Recombinant Human LEPR Protein (Gly310-Leu538), N-His tagged | +Inquiry |
LEPR-1250C | Recombinant Chicken Leptin Receptor | +Inquiry |
◆ Cell & Tissue Lysates | ||
LEPR-2175HCL | Recombinant Human LEPR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LEPR Products
Required fields are marked with *
My Review for All LEPR Products
Required fields are marked with *
0
Inquiry Basket