Recombinant Human LGALS3 protein(91-250 aa), C-His-tagged

Cat.No. : LGALS3-2677H
Product Overview : Recombinant Human LGALS3 protein(P17931)(91-250 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 91-250 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 19 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : SSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Gene Name LGALS3 lectin, galactoside-binding, soluble, 3 [ Homo sapiens ]
Official Symbol LGALS3
Synonyms LGALS3; lectin, galactoside-binding, soluble, 3; LGALS2; galectin-3; galectin 3; GALIG; MAC 2; lectin L-29; 35 kDa lectin; MAC-2 antigen; IgE-binding protein; laminin-binding protein; galactose-specific lectin 3; carbohydrate-binding protein 35; L31; GAL3; MAC2; CBP35; GALBP;
Gene ID 3958
mRNA Refseq NM_001177388
Protein Refseq NP_001170859
MIM 153619
UniProt ID P17931

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LGALS3 Products

Required fields are marked with *

My Review for All LGALS3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon