Recombinant Human LGALS3 protein(91-250 aa), C-His-tagged
Cat.No. : | LGALS3-2677H |
Product Overview : | Recombinant Human LGALS3 protein(P17931)(91-250 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 91-250 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 19 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI |
Gene Name | LGALS3 lectin, galactoside-binding, soluble, 3 [ Homo sapiens ] |
Official Symbol | LGALS3 |
Synonyms | LGALS3; lectin, galactoside-binding, soluble, 3; LGALS2; galectin-3; galectin 3; GALIG; MAC 2; lectin L-29; 35 kDa lectin; MAC-2 antigen; IgE-binding protein; laminin-binding protein; galactose-specific lectin 3; carbohydrate-binding protein 35; L31; GAL3; MAC2; CBP35; GALBP; |
Gene ID | 3958 |
mRNA Refseq | NM_001177388 |
Protein Refseq | NP_001170859 |
MIM | 153619 |
UniProt ID | P17931 |
◆ Recombinant Proteins | ||
LGALS3-3622H | Recombinant Human LGALS3 | +Inquiry |
LGALS3-392HFL | Recombinant Full Length Human LGALS3 Protein, C-Flag-tagged | +Inquiry |
LGALS3-2501R | Recombinant Rhesus monkey LGALS3 Protein, His-tagged | +Inquiry |
LGALS3-2858H | Recombinant Human LGALS3 protein, His-tagged | +Inquiry |
Lgals3-3166R | Recombinant Rat Lgals3 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LGALS3-6914H | Active Recombinant Human LGALS3 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS3-4766HCL | Recombinant Human LGALS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALS3 Products
Required fields are marked with *
My Review for All LGALS3 Products
Required fields are marked with *