| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
249 |
| Description : |
Human Galectin-3 also named AGE-R3, CBP35, GAL3, L29, LGALS3, Mac-2, is belonging to the galectins family and it is encoded by a single gene, LGALS3, located on chromosome 14, locus q21–q22. It is expressed in the nucleus, cytoplasm, mitochondrion, cell surface, and extracellular space. Galectin-3 is approximately 30 kDa and, like all galectins, contains a carbohydrate-recognition-binding domain (CRD) of about 130 amino acids that enable the specific binding of β-galactosides. Given Galectin-3’s broad biological functionality, it has been demonstrated to be involved in cancer, inflammation and fibrosis, heart disease, and stroke. Studies have also shown that the expression of galectin-3 is implicated in a variety of processes associated with heart failure, including myofibroblast proliferation, fibrogenesis, tissue repair, inflammation, and Ventricular remodeling. Human Galectin-3 shares 79% amino acid sequence identity with rat and mouse Galectin-3, respectively. |
| Form : |
Lyophilized from a 0.2μm filtered solution in 1 × PBS, pH 7.4, 3mM DTT. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by its ability to agglutinate human red blood cells is less than 10 μg/ml. |
| Molecular Mass : |
Approximately 26.0 kDa, a single non-glycosylated polypeptide chain containing 249 amino acids. |
| AA Sequence : |
ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI |
| Endotoxin : |
Less than 0.1 EU/µg of rHuGalectin-3 as determined by LAL method. |
| Purity : |
>98% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
