Recombinant Human LGALS7 protein, GST-tagged
Cat.No. : | LGALS7-301H |
Product Overview : | Recombinant Human LGALS7 protein(NP_002298)(1-136 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-136 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
Gene Name | LGALS7 lectin, galactoside-binding, soluble, 7 [ Homo sapiens ] |
Official Symbol | LGALS7 |
Synonyms | LGALS7; lectin, galactoside-binding, soluble, 7; galectin-7; GAL7; galectin 7; LGALS7A; PIG1; TP53I1; |
Gene ID | 3963 |
mRNA Refseq | NM_002307 |
Protein Refseq | NP_002298 |
MIM | 600615 |
UniProt ID | P47929 |
◆ Recombinant Proteins | ||
LGALS7-230H | Recombinant Active Human LGALS7 Protein, His-tagged(N-ter) | +Inquiry |
LGALS7-3391R | Recombinant Rat LGALS7 Protein | +Inquiry |
LGALS7-3623H | Recombinant Human LGALS7 | +Inquiry |
LGALS7-301H | Recombinant Human LGALS7 protein, GST-tagged | +Inquiry |
LGALS7-425H | Recombinant Human LGALS7 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALS7 Products
Required fields are marked with *
My Review for All LGALS7 Products
Required fields are marked with *