Recombinant Mouse LGALS7 Protein (2-136 aa), His-tagged
Cat.No. : | LGALS7-1440M |
Product Overview : | Recombinant Mouse LGALS7 Protein (2-136 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-136 aa |
Description : | Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 17.0 kDa |
AA Sequence : | SATHHKTSLPQGVRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGREERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQLHSLNIF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Lgals7 lectin, galactose binding, soluble 7 [ Mus musculus ] |
Official Symbol | LGALS7 |
Synonyms | LGALS7; galectin-7; gal-7; Pig1; Galectin-7; MGC151215; MGC151217; |
Gene ID | 16858 |
mRNA Refseq | NM_008496 |
Protein Refseq | NP_032522 |
UniProt ID | O54974 |
◆ Recombinant Proteins | ||
LGALS7-3047R | Recombinant Rat LGALS7 Protein, His (Fc)-Avi-tagged | +Inquiry |
LGALS7-529H | Recombinant Human LGALS7 Protein, MYC/DDK-tagged | +Inquiry |
Lgals7-7263M | Recombinant Mouse Lgals7 Protein, His-tagged | +Inquiry |
LGALS7-3491H | Recombinant Human LGALS7, His-tagged | +Inquiry |
LGALS7-193H | Active Recombinant Human LGALS7 Protein (Ser2-Phe136), N-His tagged, Animal-free, Carrier-free | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALS7 Products
Required fields are marked with *
My Review for All LGALS7 Products
Required fields are marked with *