Recombinant Mouse LGALS7 Protein (2-136 aa), His-tagged

Cat.No. : LGALS7-1440M
Product Overview : Recombinant Mouse LGALS7 Protein (2-136 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 2-136 aa
Description : Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 17.0 kDa
AA Sequence : SATHHKTSLPQGVRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGREERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQLHSLNIF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Lgals7 lectin, galactose binding, soluble 7 [ Mus musculus ]
Official Symbol LGALS7
Synonyms LGALS7; galectin-7; gal-7; Pig1; Galectin-7; MGC151215; MGC151217;
Gene ID 16858
mRNA Refseq NM_008496
Protein Refseq NP_032522
UniProt ID O54974

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LGALS7 Products

Required fields are marked with *

My Review for All LGALS7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon