Recombinant Mouse LGALS7 Protein (2-136 aa), His-tagged

• Cat.No.: LGALS7-1440M
• Product Overview: Recombinant Mouse LGALS7 Protein (2-136 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 2-136 aa
• Description: Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 17.0 kDa
• AA Sequence: SATHHKTSLPQGVRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGREERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQLHSLNIF
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Lgals7 lectin, galactose binding, soluble 7 [ Mus musculus ]
• Official Symbol: LGALS7
• Synonyms: LGALS7; galectin-7; gal-7; Pig1; Galectin-7; MGC151215; MGC151217
• Gene ID: 16858
• mRNA Refseq: NM_008496
• Protein Refseq: NP_032522
• UniProt ID: O54974