Recombinant Human LGALS7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LGALS7-4263H |
Product Overview : | LGALS7 MS Standard C13 and N15-labeled recombinant protein (NP_002298) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to, but on the opposite strand on chromosome 19. |
Molecular Mass : | 14.9 kDa |
AA Sequence : | MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LGALS7 galectin 7 [ Homo sapiens (human) ] |
Official Symbol | LGALS7 |
Synonyms | LGALS7; lectin, galactoside-binding, soluble, 7; galectin-7; GAL7; galectin 7; LGALS7A; PIG1; TP53I1; |
Gene ID | 3963 |
mRNA Refseq | NM_002307 |
Protein Refseq | NP_002298 |
MIM | 600615 |
UniProt ID | P47929 |
◆ Recombinant Proteins | ||
LGALS7-744H | Active Recombinant Human LGALS7 | +Inquiry |
LGALS7-193H | Active Recombinant Human LGALS7 Protein (Ser2-Phe136), N-His tagged, Animal-free, Carrier-free | +Inquiry |
LGALS7-4263H | Recombinant Human LGALS7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LGALS7-290H | Active Recombinant Human LGALS7 protein, His-tagged | +Inquiry |
Lgals7-1313M | Recombinant Mouse Lgals7 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALS7 Products
Required fields are marked with *
My Review for All LGALS7 Products
Required fields are marked with *
0
Inquiry Basket