Recombinant Human LILRA2, His-tagged
Cat.No. : | LILRA2-114H |
Product Overview : | Recombinant Human Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 2/LILRA2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gly24-Ser420) of Human LILRA2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 24-420 a.a. |
Description : | Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 2 (LILRA2) is a single-pass type I membrane protein. LILRA2 is expressed predominantly on monocytes and B cells, and at lower levels on dendritic cells and natural killer cells. LILRA2 contains four Ig-like C2-type domains, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. LILRA2 does not bind class I MHC antigens. |
AA Sequence : | GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSIT WEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFI LCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVP GVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLG PVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRG QFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPL ELVVSASVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | LILRA2 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2 [ Homo sapiens ] |
Official Symbol | LILRA2 |
Synonyms | LILRA2; leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2; leukocyte immunoglobulin-like receptor subfamily A member 2; CD85h; ILT1; LIR 7; LIR7; ILT-1; immunoglobulin-like transcript 1; CD85 antigen-like family member H; leukocyte immunoglobulin-like receptor 7; leukocyte immunoglobulin-like receptor subfamily A member 2 soluble; CD85H; LIR-7; |
Gene ID | 11027 |
mRNA Refseq | NM_001130917 |
Protein Refseq | NP_001124389 |
MIM | 604812 |
UniProt ID | Q8N149 |
Chromosome Location | 19q13.4 |
Pathway | Osteoclast differentiation, organism-specific biosystem; Osteoclast differentiation, conserved biosystem; |
Function | antigen binding; receptor activity; |
◆ Recombinant Proteins | ||
LILRA2-3957H | Recombinant Human LILRA2 Protein (Met1-Asn449), C-His tagged | +Inquiry |
LILRA2-114H | Recombinant Human LILRA2, His-tagged | +Inquiry |
LILRA2-2336H | Recombinant Human LILRA2 protein(Met1-Asn449), hFc-tagged | +Inquiry |
LILRA2-2513R | Recombinant Rhesus monkey LILRA2 Protein, His-tagged | +Inquiry |
LILRA2-149H | Recombinant Human LILRA2 protein, His-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRA2-986HCL | Recombinant Human LILRA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LILRA2 Products
Required fields are marked with *
My Review for All LILRA2 Products
Required fields are marked with *