Recombinant Human LILRA2, His-tagged
| Cat.No. : | LILRA2-114H |
| Product Overview : | Recombinant Human Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 2/LILRA2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gly24-Ser420) of Human LILRA2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 24-420 a.a. |
| Description : | Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 2 (LILRA2) is a single-pass type I membrane protein. LILRA2 is expressed predominantly on monocytes and B cells, and at lower levels on dendritic cells and natural killer cells. LILRA2 contains four Ig-like C2-type domains, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. LILRA2 does not bind class I MHC antigens. |
| AA Sequence : | GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSIT WEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFI LCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVP GVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLG PVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRG QFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPL ELVVSASVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | LILRA2 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2 [ Homo sapiens ] |
| Official Symbol | LILRA2 |
| Synonyms | LILRA2; leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2; leukocyte immunoglobulin-like receptor subfamily A member 2; CD85h; ILT1; LIR 7; LIR7; ILT-1; immunoglobulin-like transcript 1; CD85 antigen-like family member H; leukocyte immunoglobulin-like receptor 7; leukocyte immunoglobulin-like receptor subfamily A member 2 soluble; CD85H; LIR-7; |
| Gene ID | 11027 |
| mRNA Refseq | NM_001130917 |
| Protein Refseq | NP_001124389 |
| MIM | 604812 |
| UniProt ID | Q8N149 |
| Chromosome Location | 19q13.4 |
| Pathway | Osteoclast differentiation, organism-specific biosystem; Osteoclast differentiation, conserved biosystem; |
| Function | antigen binding; receptor activity; |
| ◆ Recombinant Proteins | ||
| LILRA2-2336H | Recombinant Human LILRA2 protein(Met1-Asn449), hFc-tagged | +Inquiry |
| LILRA2-1311H | Recombinant Human LILRA2 protein, His-tagged | +Inquiry |
| LILRA2-114H | Recombinant Human LILRA2, His-tagged | +Inquiry |
| LILRA2-2334R | Recombinant Rhesus Macaque LILRA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LILRA2-6899H | Recombinant Human LILRA2 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LILRA2-986HCL | Recombinant Human LILRA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LILRA2 Products
Required fields are marked with *
My Review for All LILRA2 Products
Required fields are marked with *



