Recombinant Human LILRA2, His-tagged

Cat.No. : LILRA2-114H
Product Overview : Recombinant Human Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 2/LILRA2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gly24-Ser420) of Human LILRA2 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 24-420 a.a.
Description : Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 2 (LILRA2) is a single-pass type I membrane protein. LILRA2 is expressed predominantly on monocytes and B cells, and at lower levels on dendritic cells and natural killer cells. LILRA2 contains four Ig-like C2-type domains, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. LILRA2 does not bind class I MHC antigens.
AA Sequence : GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSIT WEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFI LCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVP GVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLG PVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRG QFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPL ELVVSASVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name LILRA2 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2 [ Homo sapiens ]
Official Symbol LILRA2
Synonyms LILRA2; leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2; leukocyte immunoglobulin-like receptor subfamily A member 2; CD85h; ILT1; LIR 7; LIR7; ILT-1; immunoglobulin-like transcript 1; CD85 antigen-like family member H; leukocyte immunoglobulin-like receptor 7; leukocyte immunoglobulin-like receptor subfamily A member 2 soluble; CD85H; LIR-7;
Gene ID 11027
mRNA Refseq NM_001130917
Protein Refseq NP_001124389
MIM 604812
UniProt ID Q8N149
Chromosome Location 19q13.4
Pathway Osteoclast differentiation, organism-specific biosystem; Osteoclast differentiation, conserved biosystem;
Function antigen binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LILRA2 Products

Required fields are marked with *

My Review for All LILRA2 Products

Required fields are marked with *

0
cart-icon