Recombinant Rochalimaea henselae lipA protein, His-tagged
| Cat.No. : | lipA-4573R | 
| Product Overview : | Recombinant Rochalimaea henselae lipA protein(Q6G401)(1-320aa), fused to N-terminal His tag, was expressed in E. coli | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Rochalimaea henselae | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 1-320aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.  | 
                                
| Molecular Mass : | 40.2 kDa | 
| AA Sequence : | MVTVVDRVTDRRLRHPEKAHRPDTSVQKKPDWIRVKAPTSQVYKETHGIVRAHKLVTVCEEAGCPNIGECWSQRHASFMILGEICTRACAFCNVATGIPFAVDENEPERVADAVARMELKHVVITSVDRDDLADGGAEHFAKVIYAIRRKAPKTTIEVLTPDFRHKDGALEIVVAAKPDVFNHNLETVPSKYLKVRPGARYFHSIRLLQRVKELDPTIFTKSGIMVGLGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFVPPEEFESFAKIGKVKGFLHMASNPLTRSSHHAGDDFAILQKARDEKFALQR | 
| Purity : | Greater than 85% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. | 
| ◆ Cell & Tissue Lysates | ||
| LIPA-4727HCL | Recombinant Human LIPA 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All lipA Products
Required fields are marked with *
My Review for All lipA Products
Required fields are marked with *
  
        
    
      
            