Recombinant Human LIPA protein(22-399aa), His-tagged
Cat.No. : | LIPA-532H |
Product Overview : | Recombinant Human LIPA protein(P38571)(22-399aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-399aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ |
Gene Name | LIPA lipase A, lysosomal acid, cholesterol esterase [ Homo sapiens ] |
Official Symbol | LIPA |
Synonyms | LIPA; lipase A, lysosomal acid, cholesterol esterase; lysosomal acid lipase/cholesteryl ester hydrolase; CESD; LAL; Wolman disease; sterol esterase; cholesteryl esterase; lysosomal acid lipase; cholesterol ester hydrolase; acid cholesteryl ester hydrolase; |
Gene ID | 3988 |
mRNA Refseq | NM_000235 |
Protein Refseq | NP_000226 |
MIM | 613497 |
UniProt ID | P38571 |
◆ Recombinant Proteins | ||
Lipa-7938R | Recombinant Rat Lipa protein, His & T7-tagged | +Inquiry |
Lipa-1171R | Recombinant Rat Lipa protein, His-tagged | +Inquiry |
LIPA-7697HFL | Recombinant Full Length Human LIPA, Flag-tagged | +Inquiry |
LIPA-2158H | Recombinant Human LIPA Protein (22-399 aa), His-tagged | +Inquiry |
LIPA-6304H | Recombinant Human LIPA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIPA-4727HCL | Recombinant Human LIPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIPA Products
Required fields are marked with *
My Review for All LIPA Products
Required fields are marked with *