Recombinant Human LIPA Protein (22-399 aa), GST-tagged
Cat.No. : | LIPA-627H |
Product Overview : | Recombinant Human LIPA Protein (22-399 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 22-399 aa |
Description : | Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 70.0 kDa |
AA Sequence : | SGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | LIPA lipase A, lysosomal acid, cholesterol esterase [ Homo sapiens ] |
Official Symbol | LIPA |
Synonyms | LIPA; CESD; LAL; Wolman disease; sterol esterase; |
Gene ID | 3988 |
mRNA Refseq | NM_000235 |
Protein Refseq | NP_000226 |
MIM | 613497 |
UniProt ID | P38571 |
◆ Recombinant Proteins | ||
LIPA-532H | Recombinant Human LIPA protein(22-399aa), His-tagged | +Inquiry |
LIPA-6304H | Recombinant Human LIPA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LIPA-2533B | Recombinant Bacillus subtilis LIPA protein, His-tagged | +Inquiry |
LIPA-7697HFL | Recombinant Full Length Human LIPA, Flag-tagged | +Inquiry |
Lipa-1171R | Recombinant Rat Lipa protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIPA-4727HCL | Recombinant Human LIPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LIPA Products
Required fields are marked with *
My Review for All LIPA Products
Required fields are marked with *
0
Inquiry Basket