Recombinant Human LMAN2 protein, His-HA-tagged

• Cat.No.: LMAN2-7896H
• Product Overview: Recombinant Human LMAN2 protein(Q12907)(45-322aa), fused with N-terminal His-HA tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: HA&His
• Protein Length: 45-322aa
• Tag: N-His-HA
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.0 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
  Greater than 90% as determined by SEC-HPLC.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: DITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWR

Gene Information

• Gene Name: LMAN2 lectin, mannose-binding 2 [ Homo sapiens ]
• Official Symbol: LMAN2
• Synonyms: LMAN2; lectin, mannose-binding 2; C5orf8, chromosome 5 open reading frame 8; vesicular integral-membrane protein VIP36; GP36B; VIP36; glycoprotein GP36b; vesicular integral protein of 36 kDa; vesicular integral-membrane protein 36; C5orf8
• Gene ID: 10960
• mRNA Refseq: NM_006816
• Protein Refseq: NP_006807
• MIM: 609551
• UniProt ID: Q12907