Recombinant Human LMAN2 protein, His-HA-tagged
Cat.No. : | LMAN2-7896H |
Product Overview : | Recombinant Human LMAN2 protein(Q12907)(45-322aa), fused with N-terminal His-HA tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | HA&His |
Protein Length : | 45-322aa |
Tag : | N-His-HA |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | DITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWR |
Gene Name | LMAN2 lectin, mannose-binding 2 [ Homo sapiens ] |
Official Symbol | LMAN2 |
Synonyms | LMAN2; lectin, mannose-binding 2; C5orf8, chromosome 5 open reading frame 8; vesicular integral-membrane protein VIP36; GP36B; VIP36; glycoprotein GP36b; vesicular integral protein of 36 kDa; vesicular integral-membrane protein 36; C5orf8; |
Gene ID | 10960 |
mRNA Refseq | NM_006816 |
Protein Refseq | NP_006807 |
MIM | 609551 |
UniProt ID | Q12907 |
◆ Recombinant Proteins | ||
LMAN2-7896H | Recombinant Human LMAN2 protein, His-HA-tagged | +Inquiry |
Lman2-3797M | Recombinant Mouse Lman2 Protein, Myc/DDK-tagged | +Inquiry |
LMAN2-6979H | Recombinant Human LMAN2 protein, His-tagged | +Inquiry |
LMAN2-5201Z | Recombinant Zebrafish LMAN2 | +Inquiry |
LMAN2-053H | Recombinant Human LMAN2 Protein, HIS-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LMAN2-4718HCL | Recombinant Human LMAN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LMAN2 Products
Required fields are marked with *
My Review for All LMAN2 Products
Required fields are marked with *