Recombinant Human LRRC10 protein, His-tagged
Cat.No. : | LRRC10-194H |
Product Overview : | Recombinant Human LRRC10 protein(NP_963844)(28-277 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 28-277 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | VKLYLSDNHLNSLPPELGQLQNLQILALDFNNFKALPQVVCTLKQLCILYLGNNKLCDLPSELSLLQNLRTLWIEANCLTQLPDVVCELSLLKTLHAGSNALRLLPGQLRRLQELRTIWLSGNRLTDFPTVLLHMPFLEVIDVDWNSIRYFPSLAHLSSLKLVIYDHNPCRNAPKVAKGVRRVGRWAEETPEPDPRKARRYALVREESQELQAPVPLLPPTNS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LRRC10 leucine rich repeat containing 10 [ Homo sapiens ] |
Official Symbol | LRRC10 |
Synonyms | LRRC10; leucine rich repeat containing 10; leucine-rich repeat-containing protein 10; HRLRRP; LRRC10A; MGC125812; |
Gene ID | 376132 |
mRNA Refseq | NM_201550 |
Protein Refseq | NP_963844 |
MIM | 610846 |
UniProt ID | Q5BKY1 |
◆ Recombinant Proteins | ||
LRRC10-3756H | Recombinant Human LRRC10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LRRC10-4686H | Recombinant Human LRRC10 Protein, GST-tagged | +Inquiry |
LRRC10-194H | Recombinant Human LRRC10 protein, His-tagged | +Inquiry |
LRRC10-6027HF | Recombinant Full Length Human LRRC10 Protein, GST-tagged | +Inquiry |
Lrrc10-3822M | Recombinant Mouse Lrrc10 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC10-4650HCL | Recombinant Human LRRC10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC10 Products
Required fields are marked with *
My Review for All LRRC10 Products
Required fields are marked with *