Recombinant Human LRRC57 Protein, GST-tagged

Cat.No. : LRRC57-4650H
Product Overview : Human LRRC57 full-length ORF ( NP_694992.1, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LRRC57 (Leucine Rich Repeat Containing 57) is a Protein Coding gene. An important paralog of this gene is PIDD1.
Molecular Mass : 53.1 kDa
AA Sequence : MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVMDLSKNQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKILRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDKYMERFTATKKNFA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LRRC57 leucine rich repeat containing 57 [ Homo sapiens ]
Official Symbol LRRC57
Synonyms LRRC57; leucine rich repeat containing 57; leucine-rich repeat-containing protein 57; FLJ36812; DKFZp686H1865;
Gene ID 255252
mRNA Refseq NM_153260
Protein Refseq NP_694992
UniProt ID Q8N9N7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRRC57 Products

Required fields are marked with *

My Review for All LRRC57 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon