Recombinant Human LY6H, His-tagged

Cat.No. : LY6H-131H
Product Overview : Recombinant Human Lymphocyte Antigen 6H/LY6H is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu26-Gly115) of Human LY6H fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 26-115 a.a.
Description : Lymphocyte Antigen 6H (LY6H) is a novel member of the LY6 family of glycosylphosphatidylinositol-anchored cell surface glycoproteins. LY6H contains one UPAR/Ly6 domain. Human LY6H is synthesized as a 140 amino acid precursor that contains a 25 amino acid signal sequence, 20 amino acid propeptide that is removed in the mature form, and a 90 amino acid mature chain. LY6H is highly expressed in the brain (cerebral cortex, amygdala, hippocampus and subthalamic nucleus) and in acute human leukemic cell line MOLT-3. It is also found in lower levels in testis, pancreas, small intestine and colon. It has been shown that LY6H may play a role in both the central nervous system and the immune system.
AA Sequence : LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLM GFINSGILKVDVDCCEKDLCNGAAGLDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name LY6H lymphocyte antigen 6 complex, locus H [ Homo sapiens ]
Official Symbol LY6H
Synonyms LY6H; lymphocyte antigen 6 complex, locus H; lymphocyte antigen 6H; NMLY6; ly-6H;
Gene ID 4062
mRNA Refseq NM_001130478
Protein Refseq NP_001123950
MIM 603625
UniProt ID O94772
Chromosome Location 8q24.3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LY6H Products

Required fields are marked with *

My Review for All LY6H Products

Required fields are marked with *

0
cart-icon
0
compare icon