Recombinant Human LY6H, His-tagged
Cat.No. : | LY6H-131H |
Product Overview : | Recombinant Human Lymphocyte Antigen 6H/LY6H is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu26-Gly115) of Human LY6H fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 26-115 a.a. |
Description : | Lymphocyte Antigen 6H (LY6H) is a novel member of the LY6 family of glycosylphosphatidylinositol-anchored cell surface glycoproteins. LY6H contains one UPAR/Ly6 domain. Human LY6H is synthesized as a 140 amino acid precursor that contains a 25 amino acid signal sequence, 20 amino acid propeptide that is removed in the mature form, and a 90 amino acid mature chain. LY6H is highly expressed in the brain (cerebral cortex, amygdala, hippocampus and subthalamic nucleus) and in acute human leukemic cell line MOLT-3. It is also found in lower levels in testis, pancreas, small intestine and colon. It has been shown that LY6H may play a role in both the central nervous system and the immune system. |
AA Sequence : | LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLM GFINSGILKVDVDCCEKDLCNGAAGLDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | LY6H lymphocyte antigen 6 complex, locus H [ Homo sapiens ] |
Official Symbol | LY6H |
Synonyms | LY6H; lymphocyte antigen 6 complex, locus H; lymphocyte antigen 6H; NMLY6; ly-6H; |
Gene ID | 4062 |
mRNA Refseq | NM_001130478 |
Protein Refseq | NP_001123950 |
MIM | 603625 |
UniProt ID | O94772 |
Chromosome Location | 8q24.3 |
◆ Recombinant Proteins | ||
LY6H-413C | Recombinant Cynomolgus Monkey LY6H Protein, His (Fc)-Avi-tagged | +Inquiry |
LY6H-4568H | Recombinant Human LY6H Protein, GST-tagged | +Inquiry |
LY6H-6229HF | Recombinant Full Length Human LY6H Protein, GST-tagged | +Inquiry |
LY6H-2419R | Recombinant Rhesus Macaque LY6H Protein, His (Fc)-Avi-tagged | +Inquiry |
Ly6h-3871M | Recombinant Mouse Ly6h Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY6H-4598HCL | Recombinant Human LY6H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LY6H Products
Required fields are marked with *
My Review for All LY6H Products
Required fields are marked with *
0
Inquiry Basket