Recombinant Human LZIC Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | LZIC-1623H |
| Product Overview : | LZIC MS Standard C13 and N15-labeled recombinant protein (NP_115744) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Belongs to the CTNNBIP1 family. |
| Molecular Mass : | 21.5 kDa |
| AA Sequence : | MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | LZIC leucine zipper and CTNNBIP1 domain containing [ Homo sapiens (human) ] |
| Official Symbol | LZIC |
| Synonyms | LZIC; leucine zipper and CTNNBIP1 domain containing; protein LZIC; MGC15436; leucine zipper and CTNNBIP1 domain-containing protein; leucine zipper domain and ICAT homologous domain containing; leucine zipper and ICAT homologous domain-containing protein; |
| Gene ID | 84328 |
| mRNA Refseq | NM_032368 |
| Protein Refseq | NP_115744 |
| MIM | 610458 |
| UniProt ID | Q8WZA0 |
| ◆ Recombinant Proteins | ||
| LZIC-3678H | Recombinant Human LZIC protein, GST-tagged | +Inquiry |
| LZIC-5010H | Recombinant Human LZIC, His-tagged | +Inquiry |
| LZIC-674H | Recombinant Human LZIC, His-tagged | +Inquiry |
| Lzic-3885M | Recombinant Mouse Lzic Protein, Myc/DDK-tagged | +Inquiry |
| LZIC-4527H | Recombinant Human LZIC Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LZIC-4576HCL | Recombinant Human LZIC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LZIC Products
Required fields are marked with *
My Review for All LZIC Products
Required fields are marked with *


