Recombinant Human LZIC Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LZIC-1623H |
Product Overview : | LZIC MS Standard C13 and N15-labeled recombinant protein (NP_115744) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Belongs to the CTNNBIP1 family. |
Molecular Mass : | 21.5 kDa |
AA Sequence : | MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LZIC leucine zipper and CTNNBIP1 domain containing [ Homo sapiens (human) ] |
Official Symbol | LZIC |
Synonyms | LZIC; leucine zipper and CTNNBIP1 domain containing; protein LZIC; MGC15436; leucine zipper and CTNNBIP1 domain-containing protein; leucine zipper domain and ICAT homologous domain containing; leucine zipper and ICAT homologous domain-containing protein; |
Gene ID | 84328 |
mRNA Refseq | NM_032368 |
Protein Refseq | NP_115744 |
MIM | 610458 |
UniProt ID | Q8WZA0 |
◆ Recombinant Proteins | ||
LZIC-409H | Recombinant Human leucine zipper and CTNNBIP1 domain containing, His-tagged | +Inquiry |
LZIC-3179R | Recombinant Rat LZIC Protein, His (Fc)-Avi-tagged | +Inquiry |
LZIC-3523R | Recombinant Rat LZIC Protein | +Inquiry |
LZIC-1828C | Recombinant Chicken LZIC | +Inquiry |
LZIC-6046HF | Recombinant Full Length Human LZIC Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LZIC-4576HCL | Recombinant Human LZIC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LZIC Products
Required fields are marked with *
My Review for All LZIC Products
Required fields are marked with *
0
Inquiry Basket