Recombinant Human MAP3K3 protein, His-tagged
Cat.No. : | MAP3K3-2492H |
Product Overview : | Recombinant Human MAP3K3 protein(281-366 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | July 31, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 281-366 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | VSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | MAP3K3 mitogen-activated protein kinase kinase kinase 3 [ Homo sapiens ] |
Official Symbol | MAP3K3 |
Synonyms | MAP3K3; mitogen-activated protein kinase kinase kinase 3; MEKK3; MAP/ERK kinase kinase 3; MAPK/ERK kinase kinase 3; MAPKKK3; MEKK 3; MEK kinase 3; |
Gene ID | 4215 |
mRNA Refseq | NM_002401 |
Protein Refseq | NP_002392 |
MIM | 602539 |
UniProt ID | Q99759 |
◆ Recombinant Proteins | ||
MAP3K3-352H | Recombinant Human MAP3K3, GST-tagged, Active | +Inquiry |
MAP3K3-2669R | Recombinant Rhesus monkey MAP3K3 Protein, His-tagged | +Inquiry |
MAP3K3-1259H | Recombinant Human Mitogen-Activated Protein Kinase Kinase Kinase 3, GST-tagged | +Inquiry |
MAP3K3-30192TH | Recombinant Human MAP3K3 | +Inquiry |
MAP3K3-2492H | Recombinant Human MAP3K3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP3K3-4505HCL | Recombinant Human MAP3K3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP3K3 Products
Required fields are marked with *
My Review for All MAP3K3 Products
Required fields are marked with *