Recombinant Human MAP4K5 protein, His-tagged
| Cat.No. : | MAP4K5-3979H |
| Product Overview : | Recombinant Human MAP4K5 protein(5-274 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 5-274 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LRPAADILRRNPQQDYELVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPGDDFSLIQQEIFMVKECKHCNIVAYFGSYLSREKLWICMEYCGGGSLQDIYHVTGPLSELQIAYVCRETLQGLAYLHTKGKMHRDIKGANILLTDHGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAVEKNGGYNQLCDIWAVGITAIELGELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSSTFHNFVKIALTKNPKKRPTAERLLTH |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MAP4K5 mitogen-activated protein kinase kinase kinase kinase 5 [ Homo sapiens ] |
| Official Symbol | MAP4K5 |
| Synonyms | MAP4K5; mitogen-activated protein kinase kinase kinase kinase 5; GCKR; germinal center kinase related; KHS; KHS1; MEKKK 5; MEK kinase kinase 5; germinal center kinase-related; MAPK/ERK kinase kinase kinase 5; kinase homologous to SPS1/STE20; MAPKKKK5; |
| Gene ID | 11183 |
| mRNA Refseq | NM_006575 |
| Protein Refseq | NP_006566 |
| MIM | 604923 |
| UniProt ID | Q9Y4K4 |
| ◆ Recombinant Proteins | ||
| MAP4K5-2472H | Recombinant Human MAP4K5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MAP4K5-388H | Recombinant Human MAP4K5 Protein, MYC/DDK-tagged | +Inquiry |
| MAP4K5-1536H | Recombinant Human MAP4K5 protein, His & T7-tagged | +Inquiry |
| MAP4K5-1360H | Recombinant Human MAP4K5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MAP4K5-102HFL | Active Recombinant Full Length Human MAP4K5 Protein, N-GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAP4K5-631HCL | Recombinant Human MAP4K5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP4K5 Products
Required fields are marked with *
My Review for All MAP4K5 Products
Required fields are marked with *
