Recombinant Human MBP protein(101-190 aa), C-His-tagged

• Cat.No.: MBP-2527H
• Product Overview: Recombinant Human MBP protein(P02686)(101-190 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 101-190 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 12 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: GREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGS

Gene Information

• Gene Name: MBP myelin basic protein [ Homo sapiens ]
• Official Symbol: MBP
• Synonyms: MBP; myelin basic protein; Golli-MBP; myelin basic protein; myelin A1 protein; myelin membrane encephalitogenic protein; MGC99675
• Gene ID: 4155
• mRNA Refseq: NM_001025081
• Protein Refseq: NP_001020252
• MIM: 159430
• UniProt ID: P02686