Recombinant Human MBP protein(101-190 aa), C-His-tagged

Cat.No. : MBP-2527H
Product Overview : Recombinant Human MBP protein(P02686)(101-190 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 101-190 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 12 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : GREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGS
Gene Name MBP myelin basic protein [ Homo sapiens ]
Official Symbol MBP
Synonyms MBP; myelin basic protein; Golli-MBP; myelin basic protein; myelin A1 protein; myelin membrane encephalitogenic protein; MGC99675;
Gene ID 4155
mRNA Refseq NM_001025081
Protein Refseq NP_001020252
MIM 159430
UniProt ID P02686

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MBP Products

Required fields are marked with *

My Review for All MBP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon