Recombinant Human MBP protein(101-190 aa), C-His-tagged
Cat.No. : | MBP-2527H |
Product Overview : | Recombinant Human MBP protein(P02686)(101-190 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 101-190 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 12 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | GREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGS |
Gene Name | MBP myelin basic protein [ Homo sapiens ] |
Official Symbol | MBP |
Synonyms | MBP; myelin basic protein; Golli-MBP; myelin basic protein; myelin A1 protein; myelin membrane encephalitogenic protein; MGC99675; |
Gene ID | 4155 |
mRNA Refseq | NM_001025081 |
Protein Refseq | NP_001020252 |
MIM | 159430 |
UniProt ID | P02686 |
◆ Recombinant Proteins | ||
MBP-3445H | Recombinant Human MBP Protein, His (Fc)-Avi-tagged | +Inquiry |
MBP-286H | Recombinant Human MBP | +Inquiry |
MBP-2755P | Recombinant Pan-species (General) MBP Protein, His/MBP-tagged | +Inquiry |
MBP-389 | Recombinant Human MBP protein, His-tagged | +Inquiry |
MBP-2915HFL | Recombinant Full Length Human MBP protein, Flag-tagged | +Inquiry |
◆ Native Proteins | ||
MBP-6949M | Native Mouse Myelin basic protein | +Inquiry |
MBP-99S | Native Swine MBP | +Inquiry |
MBP-89S | Native Swine MBP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBP-4436HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
MBP-4437HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
MBP-4438HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBP Products
Required fields are marked with *
My Review for All MBP Products
Required fields are marked with *