Recombinant Human MBP protein(101-190 aa), C-His-tagged
| Cat.No. : | MBP-2527H |
| Product Overview : | Recombinant Human MBP protein(P02686)(101-190 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 101-190 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 12 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | GREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGS |
| Gene Name | MBP myelin basic protein [ Homo sapiens ] |
| Official Symbol | MBP |
| Synonyms | MBP; myelin basic protein; Golli-MBP; myelin basic protein; myelin A1 protein; myelin membrane encephalitogenic protein; MGC99675; |
| Gene ID | 4155 |
| mRNA Refseq | NM_001025081 |
| Protein Refseq | NP_001020252 |
| MIM | 159430 |
| UniProt ID | P02686 |
| ◆ Recombinant Proteins | ||
| MBP-30122H | Recombinant Human MBP protein, GST-tagged | +Inquiry |
| MBP-6949B | Bovine Myelin basic protein, Biotin-Conjugated | +Inquiry |
| MBP-01 | Recombinant MBP Protein | +Inquiry |
| MBP-6947H | Human Myelin basic protein | +Inquiry |
| Mbp-644M | Recombinant Mouse Mbp protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| MBP-6949M | Native Mouse Myelin basic protein | +Inquiry |
| MBP-89S | Native Swine MBP Protein | +Inquiry |
| MBP-99S | Native Swine MBP | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MBP-4436HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
| MBP-4438HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
| MBP-4437HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBP Products
Required fields are marked with *
My Review for All MBP Products
Required fields are marked with *



