Recombinant Human MCFD2 protein, His-tagged
| Cat.No. : | MCFD2-12H |
| Product Overview : | Recombinant Human MCFD2 protein(1-146 aa), fused with N-terminal His Tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-146 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ |
| Gene Name | MCFD2 multiple coagulation factor deficiency 2 [ Homo sapiens ] |
| Official Symbol | MCFD2 |
| Synonyms | MCFD2; multiple coagulation factor deficiency 2; multiple coagulation factor deficiency protein 2; F5F8D; LMAN1IP; SDNSF; neural stem cell derived neuronal survival protein; neural stem cell-derived neuronal survival protein; F5F8D2; DKFZp686G21263; |
| Gene ID | 90411 |
| mRNA Refseq | NM_001171506 |
| Protein Refseq | NP_001164977 |
| MIM | 607788 |
| UniProt ID | Q8NI22 |
| ◆ Recombinant Proteins | ||
| MCFD2-1836H | Recombinant Human MCFD2, T7-tagged | +Inquiry |
| MCFD2-28037TH | Recombinant Human MCFD2, T7 -tagged | +Inquiry |
| MCFD2-4405H | Recombinant Human MCFD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MCFD2-1542C | Recombinant Chicken MCFD2 | +Inquiry |
| MCFD2-29454TH | Recombinant Human MCFD2, T7 -tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MCFD2-4425HCL | Recombinant Human MCFD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCFD2 Products
Required fields are marked with *
My Review for All MCFD2 Products
Required fields are marked with *
