Recombinant Human MCFD2 protein, His-tagged
Cat.No. : | MCFD2-14H |
Product Overview : | Recombinant Human MCFD2 protein(Q8NI22)(Glu27-Gln146), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Glu27-Gln146 |
Tag : | C-His |
Form : | Phosphate buffered saline |
Storage : | Store at -20°C/-80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | EEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ |
Gene Name | MCFD2 multiple coagulation factor deficiency 2 [ Homo sapiens ] |
Official Symbol | MCFD2 |
Synonyms | MCFD2; multiple coagulation factor deficiency 2; multiple coagulation factor deficiency protein 2; F5F8D; LMAN1IP; SDNSF; neural stem cell derived neuronal survival protein; neural stem cell-derived neuronal survival protein; F5F8D2; DKFZp686G21263; |
Gene ID | 90411 |
mRNA Refseq | NM_001171506 |
Protein Refseq | NP_001164977 |
MIM | 607788 |
UniProt ID | Q8NI22 |
◆ Recombinant Proteins | ||
Mcfd2-3994M | Recombinant Mouse Mcfd2 Protein, Myc/DDK-tagged | +Inquiry |
MCFD2-1473Z | Recombinant Zebrafish MCFD2 | +Inquiry |
MCFD2-4405H | Recombinant Human MCFD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MCFD2-29454TH | Recombinant Human MCFD2, T7 -tagged | +Inquiry |
MCFD2-14H | Recombinant Human MCFD2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCFD2-4425HCL | Recombinant Human MCFD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MCFD2 Products
Required fields are marked with *
My Review for All MCFD2 Products
Required fields are marked with *
0
Inquiry Basket