Recombinant Human MCFD2 protein, His-tagged
| Cat.No. : | MCFD2-14H |
| Product Overview : | Recombinant Human MCFD2 protein(Q8NI22)(Glu27-Gln146), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | Glu27-Gln146 |
| Tag : | C-His |
| Form : | Phosphate buffered saline |
| Storage : | Store at -20°C/-80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | EEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ |
| Gene Name | MCFD2 multiple coagulation factor deficiency 2 [ Homo sapiens ] |
| Official Symbol | MCFD2 |
| Synonyms | MCFD2; multiple coagulation factor deficiency 2; multiple coagulation factor deficiency protein 2; F5F8D; LMAN1IP; SDNSF; neural stem cell derived neuronal survival protein; neural stem cell-derived neuronal survival protein; F5F8D2; DKFZp686G21263; |
| Gene ID | 90411 |
| mRNA Refseq | NM_001171506 |
| Protein Refseq | NP_001164977 |
| MIM | 607788 |
| UniProt ID | Q8NI22 |
| ◆ Recombinant Proteins | ||
| MCFD2-13H | Recombinant Human MCFD2 Protein, His-tagged | +Inquiry |
| Mcfd2-3994M | Recombinant Mouse Mcfd2 Protein, Myc/DDK-tagged | +Inquiry |
| MCFD2-12H | Recombinant Human MCFD2 protein, His-tagged | +Inquiry |
| MCFD2-28037TH | Recombinant Human MCFD2, T7 -tagged | +Inquiry |
| MCFD2-3616R | Recombinant Rat MCFD2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MCFD2-4425HCL | Recombinant Human MCFD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCFD2 Products
Required fields are marked with *
My Review for All MCFD2 Products
Required fields are marked with *
