Recombinant Human MCFD2 protein, His-tagged

• Cat.No.: MCFD2-14H
• Product Overview: Recombinant Human MCFD2 protein(Q8NI22)(Glu27-Gln146), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: Glu27-Gln146
• Tag: C-His
• Form: Phosphate buffered saline
• Storage: Store at -20°C/-80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: EEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ

Gene Information

• Gene Name: MCFD2 multiple coagulation factor deficiency 2 [ Homo sapiens ]
• Official Symbol: MCFD2
• Synonyms: MCFD2; multiple coagulation factor deficiency 2; multiple coagulation factor deficiency protein 2; F5F8D; LMAN1IP; SDNSF; neural stem cell derived neuronal survival protein; neural stem cell-derived neuronal survival protein; F5F8D2; DKFZp686G21263
• Gene ID: 90411
• mRNA Refseq: NM_001171506
• Protein Refseq: NP_001164977
• MIM: 607788
• UniProt ID: Q8NI22