Recombinant Human MCFD2 Protein, His-tagged
Cat.No. : | MCFD2-13H |
Product Overview : | Recombinant Human MCFD2 protein(Glu27-Gln146), fused with C-terminal His tag, was expressed in E. coli. |
Availability | July 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Glu27-Gln146 |
Tag : | C-His |
Form : | Liquid in sterile PBS, pH7.4. |
Molecular Mass : | The protein has a calculated MW of 15 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.0 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQAHHHHHHHHHH |
Gene Name | MCFD2 multiple coagulation factor deficiency 2 [ Homo sapiens ] |
Official Symbol | MCFD2 |
Synonyms | MCFD2; multiple coagulation factor deficiency 2; multiple coagulation factor deficiency protein 2; F5F8D; LMAN1IP; SDNSF; neural stem cell derived neuronal survival protein; neural stem cell-derived neuronal survival protein; F5F8D2; DKFZp686G21263; |
Gene ID | 90411 |
mRNA Refseq | NM_001171506 |
Protein Refseq | NP_001164977 |
MIM | 607788 |
UniProt ID | Q8NI22 |
◆ Recombinant Proteins | ||
MCFD2-1542C | Recombinant Chicken MCFD2 | +Inquiry |
MCFD2-13H | Recombinant Human MCFD2 Protein, His-tagged | +Inquiry |
MCFD2-28037TH | Recombinant Human MCFD2, T7 -tagged | +Inquiry |
MCFD2-1473Z | Recombinant Zebrafish MCFD2 | +Inquiry |
MCFD2-12H | Recombinant Human MCFD2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCFD2-4425HCL | Recombinant Human MCFD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCFD2 Products
Required fields are marked with *
My Review for All MCFD2 Products
Required fields are marked with *