Recombinant Human MCFD2 Protein, His-tagged

Cat.No. : MCFD2-13H
Product Overview : Recombinant Human MCFD2 protein(Glu27-Gln146), fused with C-terminal His tag, was expressed in E. coli.
Availability September 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Glu27-Gln146
Tag : C-His
Form : Liquid in sterile PBS, pH7.4.
Molecular Mass : The protein has a calculated MW of 15 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.0 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQAHHHHHHHHHH
Gene Name MCFD2 multiple coagulation factor deficiency 2 [ Homo sapiens ]
Official Symbol MCFD2
Synonyms MCFD2; multiple coagulation factor deficiency 2; multiple coagulation factor deficiency protein 2; F5F8D; LMAN1IP; SDNSF; neural stem cell derived neuronal survival protein; neural stem cell-derived neuronal survival protein; F5F8D2; DKFZp686G21263;
Gene ID 90411
mRNA Refseq NM_001171506
Protein Refseq NP_001164977
MIM 607788
UniProt ID Q8NI22

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MCFD2 Products

Required fields are marked with *

My Review for All MCFD2 Products

Required fields are marked with *

0
cart-icon