"MDM2" Related Products

Expand
Expand
Expand

Recombinant Human MDM2 protein, T7/His-tagged

Cat.No.: MDM2-134H
Product Overview: Recombinant human MDM2 cDNA (491aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDT YTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSV SENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESL ALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDED DEVYQVTVYQAGESDTDSFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKL ENSTQAEEGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDK EESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: MDM2 Mdm2, p53 E3 ubiquitin protein ligase homolog (mouse) [ Homo sapiens ]
Official Symbol: MDM2
Synonyms: MDM2; Mdm2, p53 E3 ubiquitin protein ligase homolog (mouse); Mdm2 p53 binding protein homolog (mouse) , Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) , mouse double minute 2, human homolog of; p53 binding protein; E3 ubiquitin-protein ligase Mdm2; HDM2; HDMX; MGC5370; oncoprotein Mdm2; MDM2 variant FB28; MDM2 variant FB30; double minute 2, human homolog of; p53-binding protein; Mdm2, transformed 3T3 cell double minute 2, p53 binding protein; hdm2; ACTFS; MGC71221;
Gene ID: 4193
mRNA Refseq: NM_002392
Protein Refseq: NP_002383
MIM: 164785
UniProt ID: Q00987
Chromosome Location: 12q13-q14
Pathway: AKT phosphorylates targets in the cytosol, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem; Aurora A signaling, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem;
Function: enzyme binding; ligase activity; metal ion binding; p53 binding; protein binding; ubiquitin-protein ligase activity; ubiquitin-protein ligase activity; zinc ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.