Recombinant Human MECR Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MECR-2530H |
Product Overview : | MECR MS Standard C13 and N15-labeled recombinant protein (NP_057095) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is an oxidoreductase that catalyzes the last step in mitochondrial fatty acid synthesis. Defects in this gene are a cause of childhood-onset dystonia and optic atrophy. |
Molecular Mass : | 40.4 kDa |
AA Sequence : | MWVCSTLWRVRTPARQWRGLLPASGCHGPAASSYSASAEPARVRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MECR mitochondrial trans-2-enoyl-CoA reductase [ Homo sapiens (human) ] |
Official Symbol | MECR |
Synonyms | MECR; mitochondrial trans-2-enoyl-CoA reductase; trans-2-enoyl-CoA reductase, mitochondrial; CGI 63; FASN2B; mitochondrial 2 enoyl thioester reductase; NRBF1; nuclear receptor binding factor 1; NRBF-1; hsNrbf-1; nuclear receptor-binding factor 1; mitochondrial 2-enoyl thioester reductase; homolog of yeast 2-enoyl thioester reductase; CGI-63; |
Gene ID | 51102 |
mRNA Refseq | NM_016011 |
Protein Refseq | NP_057095 |
MIM | 608205 |
UniProt ID | Q9BV79 |
◆ Recombinant Proteins | ||
MECR-728H | Recombinant Human MECR, His-tagged | +Inquiry |
MECR-2535R | Recombinant Rhesus Macaque MECR Protein, His (Fc)-Avi-tagged | +Inquiry |
MECR-2575Z | Recombinant Zebrafish MECR | +Inquiry |
MECR-1824H | Recombinant Human MECR protein, GST-tagged | +Inquiry |
MECR-3290R | Recombinant Rat MECR Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MECR-4394HCL | Recombinant Human MECR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MECR Products
Required fields are marked with *
My Review for All MECR Products
Required fields are marked with *