Recombinant Human MED17 protein, His-tagged
| Cat.No. : | MED17-4533H |
| Product Overview : | Recombinant Human MED17 protein(1-239 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-239 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MSGVRAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFSQGSGSEEEEAAGTEGDAQDWPGAGSSADQDDEEGVVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQNPQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLDLDKKIPED |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | MED17 |
| Synonyms | MED17; mediator complex subunit 17; cofactor required for Sp1 transcriptional activation, subunit 6 (77kD) , cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa , CRSP6; mediator of RNA polymerase II transcription subunit 17; CRSP77; DRIP80; TRAP80; ARC77; CRSP complex subunit 6; transcriptional coactivator CRSP77; activator-recruited cofactor 77 kDa component; vitamin D3 receptor-interacting protein complex 80 kDa component; thyroid hormone receptor-associated protein complex 80 kDa component; cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa; CRSP6; FLJ10812; |
| Gene ID | 9440 |
| mRNA Refseq | NM_004268 |
| Protein Refseq | NP_004259 |
| MIM | 603810 |
| UniProt ID | Q9NVC6 |
| ◆ Recombinant Proteins | ||
| MED17-4533H | Recombinant Human MED17 protein, His-tagged | +Inquiry |
| MED17-3451H | Recombinant Human MED17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MED17-804H | Recombinant Human MED17, GST-tagged | +Inquiry |
| MED17-2800H | Recombinant Human MED17 protein, His-tagged | +Inquiry |
| MED17-1427C | Recombinant Chicken MED17 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MED17-4391HCL | Recombinant Human MED17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED17 Products
Required fields are marked with *
My Review for All MED17 Products
Required fields are marked with *



