Recombinant Human MED17 protein, His-tagged

• Cat.No.: MED17-4533H
• Product Overview: Recombinant Human MED17 protein(1-239 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-239 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MSGVRAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFSQGSGSEEEEAAGTEGDAQDWPGAGSSADQDDEEGVVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQNPQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLDLDKKIPED
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: MED17
• Synonyms: MED17; mediator complex subunit 17; cofactor required for Sp1 transcriptional activation, subunit 6 (77kD) , cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa , CRSP6; mediator of RNA polymerase II transcription subunit 17; CRSP77; DRIP80; TRAP80; ARC77; CRSP complex subunit 6; transcriptional coactivator CRSP77; activator-recruited cofactor 77 kDa component; vitamin D3 receptor-interacting protein complex 80 kDa component; thyroid hormone receptor-associated protein complex 80 kDa component; cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa; CRSP6; FLJ10812
• Gene ID: 9440
• mRNA Refseq: NM_004268
• Protein Refseq: NP_004259
• MIM: 603810
• UniProt ID: Q9NVC6