Recombinant Human MED17 protein, His-tagged
Cat.No. : | MED17-4533H |
Product Overview : | Recombinant Human MED17 protein(1-239 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-239 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MSGVRAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFSQGSGSEEEEAAGTEGDAQDWPGAGSSADQDDEEGVVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQNPQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLDLDKKIPED |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | MED17 |
Synonyms | MED17; mediator complex subunit 17; cofactor required for Sp1 transcriptional activation, subunit 6 (77kD) , cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa , CRSP6; mediator of RNA polymerase II transcription subunit 17; CRSP77; DRIP80; TRAP80; ARC77; CRSP complex subunit 6; transcriptional coactivator CRSP77; activator-recruited cofactor 77 kDa component; vitamin D3 receptor-interacting protein complex 80 kDa component; thyroid hormone receptor-associated protein complex 80 kDa component; cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa; CRSP6; FLJ10812; |
Gene ID | 9440 |
mRNA Refseq | NM_004268 |
Protein Refseq | NP_004259 |
MIM | 603810 |
UniProt ID | Q9NVC6 |
◆ Recombinant Proteins | ||
MED17-2800H | Recombinant Human MED17 protein, His-tagged | +Inquiry |
MED17-5447M | Recombinant Mouse MED17 Protein, His (Fc)-Avi-tagged | +Inquiry |
MED17-9689M | Recombinant Mouse MED17 Protein | +Inquiry |
MED17-4783Z | Recombinant Zebrafish MED17 | +Inquiry |
MED17-663H | Recombinant Human MED17 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MED17-4391HCL | Recombinant Human MED17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MED17 Products
Required fields are marked with *
My Review for All MED17 Products
Required fields are marked with *
0
Inquiry Basket