"MED23" Related Products

Recombinant Human MED23 Protein, GST-tagged

Cat.No. : MED23-1906H
Product Overview : Human CRSP3 partial ORF ( NP_004821, 531 a.a. - 630 a.a.) recombinant protein with GST-tag at N-terminal.
Description : The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein also acts as a metastasis suppressor. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2012]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 36.74 kDa
AA Sequence : LTVHAKMSLIHSIATRVIKLAHAKSSVALAPALVETYSRLLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHTL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : MED23 mediator complex subunit 23 [ Homo sapiens ]
Official Symbol : MED23
Synonyms : MED23; mediator complex subunit 23; cofactor required for Sp1 transcriptional activation, subunit 3, 130kDa , CRSP3; mediator of RNA polymerase II transcription subunit 23; CRSP130; DRIP130; Sur2; 130 kDa transcriptional co-activator; 133 kDa transcriptional co-activator; vitamin D3 receptor interacting protein; activator-recruited cofactor 130 kDa component; cofactor required for Sp1 transcriptional activation subunit 3; SUR2; CRSP3; MRT18; SUR-2; ARC130; CRSP133; DKFZp434H0117;
Gene ID : 9439
mRNA Refseq : NM_004830
Protein Refseq : NP_004821
MIM : 605042
UniProt ID : Q9ULK4

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.