Recombinant Human MED23 Protein, GST-tagged
Cat.No. : | MED23-1906H |
Product Overview : | Human CRSP3 partial ORF ( NP_004821, 531 a.a. - 630 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein also acts as a metastasis suppressor. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2012] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | LTVHAKMSLIHSIATRVIKLAHAKSSVALAPALVETYSRLLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHTL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MED23 mediator complex subunit 23 [ Homo sapiens ] |
Official Symbol | MED23 |
Synonyms | MED23; mediator complex subunit 23; cofactor required for Sp1 transcriptional activation, subunit 3, 130kDa , CRSP3; mediator of RNA polymerase II transcription subunit 23; CRSP130; DRIP130; Sur2; 130 kDa transcriptional co-activator; 133 kDa transcriptional co-activator; vitamin D3 receptor interacting protein; activator-recruited cofactor 130 kDa component; cofactor required for Sp1 transcriptional activation subunit 3; SUR2; CRSP3; MRT18; SUR-2; ARC130; CRSP133; DKFZp434H0117; |
Gene ID | 9439 |
mRNA Refseq | NM_004830 |
Protein Refseq | NP_004821 |
MIM | 605042 |
UniProt ID | Q9ULK4 |
◆ Recombinant Proteins | ||
MED23-2542R | Recombinant Rhesus Macaque MED23 Protein, His (Fc)-Avi-tagged | +Inquiry |
MED23-2722R | Recombinant Rhesus monkey MED23 Protein, His-tagged | +Inquiry |
MED23-2697H | Recombinant Human MED23 protein, His-tagged | +Inquiry |
MED23-1906H | Recombinant Human MED23 Protein, GST-tagged | +Inquiry |
MED23-809H | Recombinant Human MED23, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED23 Products
Required fields are marked with *
My Review for All MED23 Products
Required fields are marked with *
0
Inquiry Basket