Recombinant Human MED23 protein, His-tagged
| Cat.No. : | MED23-2697H |
| Product Overview : | Recombinant Human MED23 protein(745 - 1059 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 745 - 1059 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | QNNVPQESRFNLKKNVEEEYRKWKSMSNENDIITHFSMQGSPPLFLCLLWKMLLETDHINQIGYRVLERIGARALVAHVRTFADFLVYEFSTSAGGQQLNKCIEILNDMVWKYNIVTLDRLILCLAMRSHEGNEAQVCYFIIQLLLLKPNDFRNRVSDFVKENSPEHWLQNDWHTKHMNYHKKYPEKLYFEGLAEQVDPPVQIQSPYLPIYFGNVCLRFLPVFDIVIHRFLELLPVSKSLETLLDHLGGLYKFHDRPVTYLYNTLHYYEMHLRDRAFLKRKLVHAIIGSLKDNRPQGWCLSDTYLKCAMNAREEN |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MED23 mediator complex subunit 23 [ Homo sapiens ] |
| Official Symbol | MED23 |
| Synonyms | MED23; mediator complex subunit 23; cofactor required for Sp1 transcriptional activation, subunit 3, 130kDa , CRSP3; mediator of RNA polymerase II transcription subunit 23; CRSP130; DRIP130; Sur2; 130 kDa transcriptional co-activator; 133 kDa transcriptional co-activator; vitamin D3 receptor interacting protein; activator-recruited cofactor 130 kDa component; cofactor required for Sp1 transcriptional activation subunit 3; SUR2; CRSP3; MRT18; SUR-2; ARC130; CRSP133; DKFZp434H0117; |
| Gene ID | 9439 |
| mRNA Refseq | NM_004830 |
| Protein Refseq | NP_004821 |
| MIM | 605042 |
| UniProt ID | Q9ULK4 |
| ◆ Recombinant Proteins | ||
| MED23-809H | Recombinant Human MED23, GST-tagged | +Inquiry |
| MED23-1189Z | Recombinant Zebrafish MED23 | +Inquiry |
| MED23-3121H | Recombinant Human MED23 protein, His-tagged | +Inquiry |
| MED23-2697H | Recombinant Human MED23 protein, His-tagged | +Inquiry |
| MED23-2542R | Recombinant Rhesus Macaque MED23 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED23 Products
Required fields are marked with *
My Review for All MED23 Products
Required fields are marked with *
