Recombinant Human MED23 protein, His-tagged

• Cat.No.: MED23-2697H
• Product Overview: Recombinant Human MED23 protein(745 - 1059 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 745 - 1059 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: QNNVPQESRFNLKKNVEEEYRKWKSMSNENDIITHFSMQGSPPLFLCLLWKMLLETDHINQIGYRVLERIGARALVAHVRTFADFLVYEFSTSAGGQQLNKCIEILNDMVWKYNIVTLDRLILCLAMRSHEGNEAQVCYFIIQLLLLKPNDFRNRVSDFVKENSPEHWLQNDWHTKHMNYHKKYPEKLYFEGLAEQVDPPVQIQSPYLPIYFGNVCLRFLPVFDIVIHRFLELLPVSKSLETLLDHLGGLYKFHDRPVTYLYNTLHYYEMHLRDRAFLKRKLVHAIIGSLKDNRPQGWCLSDTYLKCAMNAREEN
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MED23 mediator complex subunit 23 [ Homo sapiens ]
• Official Symbol: MED23
• Synonyms: MED23; mediator complex subunit 23; cofactor required for Sp1 transcriptional activation, subunit 3, 130kDa , CRSP3; mediator of RNA polymerase II transcription subunit 23; CRSP130; DRIP130; Sur2; 130 kDa transcriptional co-activator; 133 kDa transcriptional co-activator; vitamin D3 receptor interacting protein; activator-recruited cofactor 130 kDa component; cofactor required for Sp1 transcriptional activation subunit 3; SUR2; CRSP3; MRT18; SUR-2; ARC130; CRSP133; DKFZp434H0117
• Gene ID: 9439
• mRNA Refseq: NM_004830
• Protein Refseq: NP_004821
• MIM: 605042
• UniProt ID: Q9ULK4