Recombinant Human MELK protein, His&Myc-tagged
Cat.No. : | MELK-4388H |
Product Overview : | Recombinant Human MELK protein(Q14680)(1-340aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-340aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.3 kDa |
AA Sequence : | MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCG |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | MELK maternal embryonic leucine zipper kinase [ Homo sapiens ] |
Official Symbol | MELK |
Synonyms | MELK; maternal embryonic leucine zipper kinase; KIAA0175; pEg3 kinase; protein kinase Eg3; protein kinase PK38; tyrosine-protein kinase MELK; HPK38; |
Gene ID | 9833 |
mRNA Refseq | NM_001256685 |
Protein Refseq | NP_001243614 |
MIM | 607025 |
UniProt ID | Q14680 |
◆ Recombinant Proteins | ||
MELK-1134H | Recombinant Human MELK Protein (D3-V330), Tag Free | +Inquiry |
MELK-4388H | Recombinant Human MELK protein, His&Myc-tagged | +Inquiry |
MELK-4447H | Recombinant Human MELK Protein, GST-tagged | +Inquiry |
MELK-9725M | Recombinant Mouse MELK Protein | +Inquiry |
MELK-1430H | Active Recombinant Human MELK, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MELK-4368HCL | Recombinant Human MELK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MELK Products
Required fields are marked with *
My Review for All MELK Products
Required fields are marked with *