Recombinant Human METTL14 Protein, GST-tagged
Cat.No. : | METTL14-4410H |
Product Overview : | Human METTL14 full-length ORF ( NP_066012.1, 1 a.a. - 456 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | METTL14 (Methyltransferase Like 14) is a Protein Coding gene. Among its related pathways are Gene Expression and mRNA Splicing - Major Pathway. GO annotations related to this gene include RNA binding and mRNA (2-O-methyladenosine-N6-)-methyltransferase activity. |
Molecular Mass : | 78.6 kDa |
AA Sequence : | MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | METTL14 methyltransferase like 14 [ Homo sapiens (human) ] |
Official Symbol | METTL14 |
Synonyms | METTL14; methyltransferase like 14; Hmettl14; N6-adenosine-methyltransferase subunit METTL14; methyltransferase-like protein 14; EC 2.1.1.62 |
Gene ID | 57721 |
mRNA Refseq | NM_020961 |
Protein Refseq | NP_066012 |
MIM | 616504 |
UniProt ID | Q9HCE5 |
◆ Recombinant Proteins | ||
METTL14-925HFL | Recombinant Full Length Human METTL14 Protein, C-Flag-tagged | +Inquiry |
METTL14-2739R | Recombinant Rhesus monkey METTL14 Protein, His-tagged | +Inquiry |
METTL14-4410H | Recombinant Human METTL14 Protein, GST-tagged | +Inquiry |
METTL14-33H | Recombinant Human METTL14 protein (Full Length), N-FLAG-tagged | +Inquiry |
METTL14-3785H | Recombinant Human METTL14 Protein (Full length), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL14-4358HCL | Recombinant Human METTL14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL14 Products
Required fields are marked with *
My Review for All METTL14 Products
Required fields are marked with *