Recombinant Human MFGE8 Protein (24-387 aa), His-SUMO-tagged

• Cat.No.: MFGE8-652H
• Product Overview: Recombinant Human MFGE8 Protein (24-387 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 24-387 aa
• Description: Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization . Contributes to phagocytic roval of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction. Binds specifically to rotavirus and inhibits its replication.1 Publication.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 56.8 kDa
• AA Sequence: LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: MFGE8 milk fat globule-EGF factor 8 protein [ Homo sapiens ]
• Official Symbol: MFGE8
• Synonyms: MFGE8; lactadherin; BA46; EDIL1; hP47; HsT19888; MFG E8; OAcGD3S; SED1; medin; HMFG; MFGM; MFG-E8; SPAG10
• Gene ID: 4240
• mRNA Refseq: NM_001114614
• Protein Refseq: NP_001108086
• MIM: 602281
• UniProt ID: Q08431