Recombinant Human MIB1 Protein, GST-tagged

Cat.No. : MIB1-5316H
Product Overview : Human MIB1 partial ORF ( NP_065825, 909 a.a. - 1006 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein containing multiple ankyrin repeats and RING finger domains that functions as an E3 ubiquitin ligase. The encoded protein positively regulates Notch signaling by ubiquitinating the Notch receptors, thereby facilitating their endocytosis. This protein may also promote the ubiquitination and degradation of death-associated protein kinase 1 (DAPK1). [provided by RefSeq, Jun 2013]
Molecular Mass : 36.52 kDa
AA Sequence : PFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MIB1 mindbomb E3 ubiquitin protein ligase 1 [ Homo sapiens ]
Official Symbol MIB1
Synonyms MIB1; mindbomb E3 ubiquitin protein ligase 1; mindbomb homolog 1 (Drosophila); E3 ubiquitin-protein ligase MIB1; DIP 1; KIAA1323; MIB; ZZANK2; ZZZ6; mindbomb homolog 1; mind bomb homolog 1; DAPK-interacting protein 1; ubiquitin ligase mind bomb; ubiquitin ligase protein MIB1; zinc finger ZZ type with ankyrin repeat domain protein 2; DIP-1; FLJ90676; MGC129659; MGC129660; DKFZp686I0769; DKFZp761M1710;
Gene ID 57534
mRNA Refseq NM_020774
Protein Refseq NP_065825
MIM 608677
UniProt ID Q86YT6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MIB1 Products

Required fields are marked with *

My Review for All MIB1 Products

Required fields are marked with *

0
cart-icon