Recombinant Human MIB1 Protein, GST-tagged
Cat.No. : | MIB1-5316H |
Product Overview : | Human MIB1 partial ORF ( NP_065825, 909 a.a. - 1006 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein containing multiple ankyrin repeats and RING finger domains that functions as an E3 ubiquitin ligase. The encoded protein positively regulates Notch signaling by ubiquitinating the Notch receptors, thereby facilitating their endocytosis. This protein may also promote the ubiquitination and degradation of death-associated protein kinase 1 (DAPK1). [provided by RefSeq, Jun 2013] |
Molecular Mass : | 36.52 kDa |
AA Sequence : | PFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MIB1 mindbomb E3 ubiquitin protein ligase 1 [ Homo sapiens ] |
Official Symbol | MIB1 |
Synonyms | MIB1; mindbomb E3 ubiquitin protein ligase 1; mindbomb homolog 1 (Drosophila); E3 ubiquitin-protein ligase MIB1; DIP 1; KIAA1323; MIB; ZZANK2; ZZZ6; mindbomb homolog 1; mind bomb homolog 1; DAPK-interacting protein 1; ubiquitin ligase mind bomb; ubiquitin ligase protein MIB1; zinc finger ZZ type with ankyrin repeat domain protein 2; DIP-1; FLJ90676; MGC129659; MGC129660; DKFZp686I0769; DKFZp761M1710; |
Gene ID | 57534 |
mRNA Refseq | NM_020774 |
Protein Refseq | NP_065825 |
MIM | 608677 |
UniProt ID | Q86YT6 |
◆ Recombinant Proteins | ||
MIB1-1883H | Recombinant Human MIB1 protein, His & T7-tagged | +Inquiry |
MIB1-1353H | Recombinant Human MIB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MIB1-124HFL | Active Recombinant Full Length Human MIB1 Protein, C-Flag-tagged | +Inquiry |
MIB1-5316H | Recombinant Human MIB1 Protein, GST-tagged | +Inquiry |
MIB1-1409H | Recombinant Human MIB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIB1-4324HCL | Recombinant Human MIB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIB1 Products
Required fields are marked with *
My Review for All MIB1 Products
Required fields are marked with *
0
Inquiry Basket