Recombinant Human MKLN1 Protein, GST-tagged
| Cat.No. : | MKLN1-5364H |
| Product Overview : | Human MKLN1 partial ORF ( NP_037387, 633 a.a. - 735 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Muskelin is an intracellular protein that acts as a mediator of cell spreading and cytoskeletal responses to the extracellular matrix component thrombospondin I (MIM 188060) (Adams et al., 1998 [PubMed 9724633]).[supplied by OMIM |
| Molecular Mass : | 37.07 kDa |
| AA Sequence : | RHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDPEETKEFQLLASALFKSGSDFTALGFSDVDHTYAQRTQLFDTLVNFFPDSMTPPKGNLVDLITL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MKLN1 muskelin 1, intracellular mediator containing kelch motifs [ Homo sapiens ] |
| Official Symbol | MKLN1 |
| Synonyms | MKLN1; muskelin 1, intracellular mediator containing kelch motifs; muskelin; TWA2; FLJ11162; |
| Gene ID | 4289 |
| mRNA Refseq | NM_001145354 |
| Protein Refseq | NP_001138826 |
| MIM | 605623 |
| UniProt ID | Q9UL63 |
| ◆ Recombinant Proteins | ||
| Mkln1-4082M | Recombinant Mouse Mkln1 Protein, Myc/DDK-tagged | +Inquiry |
| MKLN1-5573M | Recombinant Mouse MKLN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MKLN1-2472C | Recombinant Chicken MKLN1 | +Inquiry |
| MKLN1-9863M | Recombinant Mouse MKLN1 Protein | +Inquiry |
| MKLN1-4003H | Recombinant Human MKLN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MKLN1-4304HCL | Recombinant Human MKLN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MKLN1 Products
Required fields are marked with *
My Review for All MKLN1 Products
Required fields are marked with *
