Recombinant Human MKLN1 Protein, GST-tagged

Cat.No. : MKLN1-5364H
Product Overview : Human MKLN1 partial ORF ( NP_037387, 633 a.a. - 735 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Muskelin is an intracellular protein that acts as a mediator of cell spreading and cytoskeletal responses to the extracellular matrix component thrombospondin I (MIM 188060) (Adams et al., 1998 [PubMed 9724633]).[supplied by OMIM
Molecular Mass : 37.07 kDa
AA Sequence : RHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDPEETKEFQLLASALFKSGSDFTALGFSDVDHTYAQRTQLFDTLVNFFPDSMTPPKGNLVDLITL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MKLN1 muskelin 1, intracellular mediator containing kelch motifs [ Homo sapiens ]
Official Symbol MKLN1
Synonyms MKLN1; muskelin 1, intracellular mediator containing kelch motifs; muskelin; TWA2; FLJ11162;
Gene ID 4289
mRNA Refseq NM_001145354
Protein Refseq NP_001138826
MIM 605623
UniProt ID Q9UL63

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MKLN1 Products

Required fields are marked with *

My Review for All MKLN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon