Recombinant Human MLANA
| Cat.No. : | MLANA-30193TH |
| Product Overview : | Recombinant full length Human MelanA with N terminal proprietary tag; Predicted MWt 39.09 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 118 amino acids |
| Description : | MART-1 / Melan-A is a protein antigen found on melanocytes. Antibodies against the antigen are used in the medical specialty of anatomic pathology in order to recognize cells of melanocytic differentiation, useful for the diagnosis of a melanoma. |
| Molecular Weight : | 39.090kDa inclusive of tags |
| Tissue specificity : | Expression is restricted to melanoma and melanocyte cell lines and retina. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVL LLIGCWYCRRRNGYRALMDKSLHVGTQCALTRRCPQEGFD HRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP |
| Gene Name | MLANA melan-A [ Homo sapiens ] |
| Official Symbol | MLANA |
| Synonyms | MLANA; melan-A; melanoma antigen recognized by T-cells 1; MART1; |
| Gene ID | 2315 |
| mRNA Refseq | NM_005511 |
| Protein Refseq | NP_005502 |
| MIM | 605513 |
| Uniprot ID | Q16655 |
| Chromosome Location | 9p24.1 |
| Function | protein binding; |
| ◆ Recombinant Proteins | ||
| MLANA-585H | Recombinant Human MLANA Protein, MYC/DDK-tagged | +Inquiry |
| MLANA-1658H | Recombinant Human MLANA Protein (1-118 aa), His-tagged | +Inquiry |
| MLANA-882H | Recombinant Human MLANA protein, His-tagged | +Inquiry |
| MLANA-1074HFL | Recombinant Full Length Human MLANA Protein, C-Flag-tagged | +Inquiry |
| MLANA-1282H | Recombinant Human MLANA Protein, His-B2M-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MLANA-411HCL | Recombinant Human MLANA lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MLANA Products
Required fields are marked with *
My Review for All MLANA Products
Required fields are marked with *
