Recombinant Full Length Human MLANA Protein, C-Flag-tagged
Cat.No. : | MLANA-1074HFL |
Product Overview : | Recombinant Full Length Human MLANA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Located in endoplasmic reticulum membrane; melanosome; and trans-Golgi network. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 13 kDa |
AA Sequence : | MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDKSLHVGTQCAL TRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | MLANA melan-A [ Homo sapiens (human) ] |
Official Symbol | MLANA |
Synonyms | MART1; MART-1 |
Gene ID | 2315 |
mRNA Refseq | NM_005511.2 |
Protein Refseq | NP_005502.1 |
MIM | 605513 |
UniProt ID | Q16655 |
◆ Recombinant Proteins | ||
MLANA-2040H | Recombinant Human MLANA, GST-tagged | +Inquiry |
MLANA-6349HF | Recombinant Full Length Human MLANA Protein, GST-tagged | +Inquiry |
MLANA-30193TH | Recombinant Human MLANA | +Inquiry |
MLANA-1282H | Recombinant Human MLANA Protein, His-B2M-tagged | +Inquiry |
MLANA-585H | Recombinant Human MLANA Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MLANA-411HCL | Recombinant Human MLANA lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MLANA Products
Required fields are marked with *
My Review for All MLANA Products
Required fields are marked with *
0
Inquiry Basket