Recombinant Human MMP13 protein(361-430 aa), C-His-tagged
| Cat.No. : | MMP13-2765H |
| Product Overview : | Recombinant Human MMP13 protein(P45452)(361-430 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 361-430 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDK |
| Gene Name | MMP13 matrix metallopeptidase 13 (collagenase 3) [ Homo sapiens ] |
| Official Symbol | MMP13 |
| Synonyms | MMP13; matrix metallopeptidase 13 (collagenase 3); matrix metalloproteinase 13 (collagenase 3); collagenase 3; CLG3; MMP-13; MANDP1; |
| Gene ID | 4322 |
| mRNA Refseq | NM_002427 |
| Protein Refseq | NP_002418 |
| MIM | 600108 |
| UniProt ID | P45452 |
| ◆ Recombinant Proteins | ||
| MMP13-42H | Recombinant Human MMP-13 | +Inquiry |
| MMP13-5421H | Recombinant Human MMP13 Protein, GST-tagged | +Inquiry |
| MMP13-6454HF | Recombinant Full Length Human MMP13 Protein, GST-tagged | +Inquiry |
| MMP13-239H | Recombinant Active Human MMP13 Protein, His-tagged(C-ter) | +Inquiry |
| MMP13-733P | Recombinant Pig MMP13 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MMP13-4280HCL | Recombinant Human MMP13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP13 Products
Required fields are marked with *
My Review for All MMP13 Products
Required fields are marked with *



